Comparing WP_092053257.1 NCBI__GCF_900111775.1:WP_092053257.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7dyrZ Cryoem structure of mannose transporter manyz and microcin e492 (mcea) complex (see paper)
45% identity, 61% coverage: 10:159/244 of query aligns to 12:164/274 of 7dyrZ
8hfsZ The structure of lcna, lcia, and the man-pts of lactococcus lactis (see paper)
46% identity, 56% coverage: 6:141/244 of query aligns to 8:145/303 of 8hfsZ
7vlxZ Cryo-em structures of listeria monocytogenes man-pts (see paper)
44% identity, 56% coverage: 7:142/244 of query aligns to 7:144/298 of 7vlxZ
7xnoZ Cryo-em structure of the bacteriocin-receptor-immunity ternary complex from lactobacillus sakei (see paper)
45% identity, 55% coverage: 7:141/244 of query aligns to 10:146/301 of 7xnoZ
>WP_092053257.1 NCBI__GCF_900111775.1:WP_092053257.1
MLPLGIRLRILLRLPLLQASWNYERMQSLGVLYILYPALRFIYRDEDLVLACQRHLEYFN
SHPFMAGPILGTTLALEEERSLHAEGSLDVSEFKGMIMAPFAAMGDAFFWGGLRPLAAAL
ALLLAAAGFWWAPLAFLLLFNLPHGWALIAGLHGGYRYGPGMIGRVQRYHLPDLAVRCKE
GTALLLGALSAVLVSDTLRGAEVALAWGPCALLPVVLLGGLARLGVSNLILILLMSAVLL
VFFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory