Comparing WP_092053462.1 NCBI__GCF_900111775.1:WP_092053462.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ydbA Crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
59% identity, 93% coverage: 1:124/133 of query aligns to 13:136/145 of 5ydbA
Sites not aligning to the query:
5b6pB Structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution (see paper)
59% identity, 93% coverage: 1:124/133 of query aligns to 13:136/145 of 5b6pB
Sites not aligning to the query:
8idrC Crystal structure of apo-form of dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
55% identity, 96% coverage: 1:128/133 of query aligns to 14:140/147 of 8idrC
3n8kM Type ii dehydroquinase from mycobacterium tuberculosis complexed with citrazinic acid (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 23:148/151 of 3n8kM
Sites not aligning to the query:
4cl0A Structure of the mycobacterium tuberculosis type ii dehydroquinase inhibited by a 3-dehydroquinic acid derivative
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/140 of 4cl0A
Sites not aligning to the query:
4b6pA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/142 of 4b6pA
Sites not aligning to the query:
3n76A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with compound 5 (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 15:140/143 of 3n76A
Sites not aligning to the query:
4kiwA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49e [5-[(3-nitrobenzyl)amino]benzene-1,3-dicarboxylic acid] (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/141 of 4kiwA
Sites not aligning to the query:
4kiuA Design and structural analysis of aromatic inhibitors of type ii dehydroquinate dehydratase from mycobacterium tuberculosis - compound 49d [5-[(3-nitrobenzyl)oxy]benzene-1,3-dicarboxylic acid] (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/141 of 4kiuA
Sites not aligning to the query:
4ciwA Crystal structure of mycobacterium tuberculosis type 2 dehydroquinase in complex with (1r,4r,5r)-1,4,5-trihydroxy-3-(2-hydroxy) ethylcyclohex-2-ene-1-carboxylic acid (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/141 of 4ciwA
Sites not aligning to the query:
3n87A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 3 (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/141 of 3n87A
Sites not aligning to the query:
3n86A Crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 4 (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/141 of 3n86A
Sites not aligning to the query:
2xb8A Structure of mycobacterium tuberculosis type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3- dehydroquinic acid (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 14:139/141 of 2xb8A
Sites not aligning to the query:
4b6oA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 15:140/142 of 4b6oA
Sites not aligning to the query:
3n59C Type ii dehydroquinase from mycobacterium tuberculosis complexed with 3-dehydroshikimate (see paper)
54% identity, 95% coverage: 2:128/133 of query aligns to 15:140/142 of 3n59C
Sites not aligning to the query:
Q48255 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
46% identity, 95% coverage: 1:127/133 of query aligns to 13:141/167 of Q48255
4b6sA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
46% identity, 95% coverage: 1:127/133 of query aligns to 13:141/158 of 4b6sA
Sites not aligning to the query:
2xb9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3-dehydroquinic acid (see paper)
46% identity, 95% coverage: 1:127/133 of query aligns to 13:141/158 of 2xb9A
Sites not aligning to the query:
1j2yA Crystal structure of the type ii 3-dehydroquinase (see paper)
46% identity, 95% coverage: 1:127/133 of query aligns to 13:141/158 of 1j2yA
Sites not aligning to the query:
4b6rA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
46% identity, 95% coverage: 1:127/133 of query aligns to 13:141/157 of 4b6rA
Sites not aligning to the query:
>WP_092053462.1 NCBI__GCF_900111775.1:WP_092053462.1
MLGTREPGIYGARTLDDIHAELSGLAEELGLSLEFFQSNHEGALIDRIHQAWRDGVAGLI
LNPGGLTHTSVSLRDALSAVAIPTVEVHLSNIHARETFRQHSYIAPVALGQICGFGPIGY
ELALRALSVKLKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory