SitesBLAST
Comparing WP_092053855.1 NCBI__GCF_900111775.1:WP_092053855.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0R066 Branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
51% identity, 93% coverage: 22:351/354 of query aligns to 30:364/368 of A0R066
- R101 (= R93) binding
- Y209 (= Y200) binding
- K299 (≠ E286) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- T314 (= T301) binding
3dtgA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design
51% identity, 93% coverage: 22:351/354 of query aligns to 25:359/363 of 3dtgA
- active site: K199 (= K195)
- binding O-benzylhydroxylamine: F72 (= F69), Y171 (= Y167), Y204 (= Y200)
- binding pyridoxal-5'-phosphate: R96 (= R93), R189 (= R185), K199 (= K195), Y204 (= Y200), E235 (= E231), G238 (≠ S234), L263 (= L255), I266 (= I258), T267 (= T259), T309 (= T301)
3dtfA Structural analysis of mycobacterial branched chain aminotransferase- implications for inhibitor design (see paper)
51% identity, 93% coverage: 22:351/354 of query aligns to 25:359/363 of 3dtfA
3ht5A Crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis (see paper)
50% identity, 92% coverage: 28:351/354 of query aligns to 3:331/335 of 3ht5A
- active site: K171 (= K195)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R68 (= R93), K171 (= K195), Y176 (= Y200), E207 (= E231), G210 (≠ S234), M211 (= M235), N212 (= N236), L235 (= L255), G237 (= G257), I238 (= I258), T239 (= T259), T281 (= T301)
5u3fA Structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative (see paper)
48% identity, 92% coverage: 28:351/354 of query aligns to 2:322/326 of 5u3fA
- active site: K162 (= K195)
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G45 (= G71), R67 (= R93), Y110 (= Y135), K162 (= K195), Y167 (= Y200), E198 (= E231), G201 (≠ S234), M202 (= M235), N203 (= N236), L226 (= L255), G228 (= G257), I229 (= I258), T230 (= T259), T272 (= T301)
7nyaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor bay-069 (compound 36) (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 21:354/364 of 7nyaA
- binding pyridoxal-5'-phosphate: R97 (= R93), R190 (= R185), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (≠ S234), M239 (= M235), L264 (= L255), G266 (= G257), V267 (≠ I258), T268 (= T259), G310 (= G300), T311 (= T301)
- binding 3-[4-chloranyl-3-(2-methylphenoxy)naphthalen-1-yl]-6-(trifluoromethyl)-5~{H}-pyrimidine-2,4-dione: F27 (= F23), Y68 (= Y64), F73 (= F69), Y139 (= Y135), G152 (= G148), V153 (= V149), Y171 (= Y167), Q212 (≠ S207), Q222 (= Q217), T238 (≠ S234), A312 (= A302)
7ny9A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 38 (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 21:354/364 of 7ny9A
- binding pyridoxal-5'-phosphate: R97 (= R93), R190 (= R185), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (≠ S234), M239 (= M235), N240 (= N236), L264 (= L255), G266 (= G257), V267 (≠ I258), T268 (= T259), T311 (= T301)
- binding 3-[2,6-bis(oxidanylidene)-4-(trifluoromethyl)-5~{H}-pyrimidin-1-yl]-~{N}-methyl-2-pyridin-2-yl-imidazo[1,2-a]pyridine-7-carboxamide: F27 (= F23), Y139 (= Y135), G152 (= G148), V153 (= V149), Y171 (= Y167), Q212 (≠ S207), Q221 (≠ D216), Q222 (= Q217), V223 (= V218), T238 (≠ S234)
7ny2A Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 35 (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 21:354/364 of 7ny2A
- binding pyridoxal-5'-phosphate: R97 (= R93), K200 (= K195), Y205 (= Y200), E235 (= E231), T238 (≠ S234), M239 (= M235), L264 (= L255), G266 (= G257), V267 (≠ I258), T268 (= T259), T311 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-2-(2-methylphenoxy)naphthalene-1-carbonitrile: F27 (= F23), Y139 (= Y135), G152 (= G148), V153 (= V149), Y171 (= Y167), Q212 (≠ S207), Q222 (= Q217), A312 (= A302)
7nwmA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 12 (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 22:355/365 of 7nwmA
- binding pyridoxal-5'-phosphate: R98 (= R93), R191 (= R185), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (≠ S234), M240 (= M235), L265 (= L255), G267 (= G257), V268 (≠ I258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methoxy-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F23), Y69 (= Y64), F74 (= F69), Y140 (= Y135), G153 (= G148), V154 (= V149), Y172 (= Y167), Q213 (≠ S207), Q223 (= Q217), T239 (≠ S234), A313 (= A302)
7nweA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 10 (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 22:355/365 of 7nweA
- binding pyridoxal-5'-phosphate: R98 (= R93), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (≠ S234), M240 (= M235), L265 (= L255), G267 (= G257), V268 (≠ I258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-methyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F23), Y69 (= Y64), F74 (= F69), Y140 (= Y135), G153 (= G148), V154 (= V149), Y172 (= Y167), Q213 (≠ S207), Q223 (= Q217), T239 (≠ S234), A313 (= A302)
7nwcA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 2 (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 22:355/365 of 7nwcA
- binding pyridoxal-5'-phosphate: R98 (= R93), R191 (= R185), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (≠ S234), M240 (= M235), N241 (= N236), L265 (= L255), G267 (= G257), V268 (≠ I258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 3-(5-chloranyl-2,4-dimethoxy-phenyl)-6-(trifluoromethyl)-1H-pyrimidine-2,4-dione: F28 (= F23), Y172 (= Y167), Q223 (= Q217), T239 (≠ S234), A313 (= A302)
7nwbA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and inhibitor compound 1 (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 22:355/365 of 7nwbA
- binding pyridoxal-5'-phosphate: R98 (= R93), R191 (= R185), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (≠ S234), M240 (= M235), L265 (= L255), G267 (= G257), V268 (≠ I258), T269 (= T259), G311 (= G300), T312 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(trifluoromethyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F23), Y69 (= Y64), F74 (= F69), Y140 (= Y135), G153 (= G148), V154 (= V149), Y172 (= Y167), Q213 (≠ S207), Q223 (= Q217), A313 (= A302)
7nwaA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and compound a (see paper)
45% identity, 92% coverage: 17:343/354 of query aligns to 22:355/365 of 7nwaA
- binding pyridoxal-5'-phosphate: R98 (= R93), K201 (= K195), Y206 (= Y200), E236 (= E231), T239 (≠ S234), N241 (= N236), L265 (= L255), G267 (= G257), V268 (≠ I258), T269 (= T259), T312 (= T301)
- binding 2-[[4-chloranyl-2,6-bis(fluoranyl)phenyl]methylamino]-7-oxidanylidene-5-propyl-4H-pyrazolo[1,5-a]pyrimidine-3-carbonitrile: R142 (= R137), G153 (= G148), V154 (= V149), Y172 (= Y167), F173 (≠ Y168), V181 (= V175), Q223 (= Q217), V237 (= V232), T239 (≠ S234), M240 (= M235), G311 (= G300), A313 (= A302), C317 (≠ S306)
7nxoA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 24(5-f) (see paper)
44% identity, 92% coverage: 17:343/354 of query aligns to 21:351/361 of 7nxoA
- binding pyridoxal-5'-phosphate: R97 (= R93), K197 (= K195), Y202 (= Y200), E232 (= E231), T235 (≠ S234), M236 (= M235), N237 (= N236), L261 (= L255), G263 (= G257), V264 (≠ I258), T265 (= T259), T308 (= T301)
- binding 4-[2,4-bis(oxidanylidene)-6-(phenylsulfonyl)-1H-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F27 (= F23), Y68 (= Y64), F73 (= F69), G152 (= G148), V153 (= V149), Y171 (= Y167), F172 (≠ Y168), Q209 (≠ S207), Q218 (≠ D216), Q219 (= Q217), T235 (≠ S234)
7nxnA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and small molecule inhibitor compound 21(5-f) (see paper)
44% identity, 92% coverage: 17:343/354 of query aligns to 22:352/362 of 7nxnA
- binding pyridoxal-5'-phosphate: R98 (= R93), R188 (= R185), K198 (= K195), Y203 (= Y200), E233 (= E231), T236 (≠ S234), M237 (= M235), N238 (= N236), L262 (= L255), G264 (= G257), V265 (≠ I258), T266 (= T259), T309 (= T301)
- binding 4-[6-[bis(fluoranyl)-phenyl-methyl]-2,4-bis(oxidanylidene)-1~{H}-pyrimidin-3-yl]-5-fluoranyl-2-(2-methylphenoxy)benzenecarbonitrile: F28 (= F23), Y69 (= Y64), F74 (= F69), G153 (= G148), V154 (= V149), Y172 (= Y167), Q210 (≠ S207), Q219 (≠ D216), Q220 (= Q217), T236 (≠ S234)
7ntrA Crystal structure of human cytosolic branched-chain aminotransferase (bcat1) in complex with plp and substrate mimic 3-phenylpropionate (see paper)
44% identity, 92% coverage: 17:343/354 of query aligns to 22:352/362 of 7ntrA
- binding hydrocinnamic acid: F28 (= F23), Y69 (= Y64), V154 (= V149), T236 (≠ S234), G308 (= G300), T309 (= T301), A310 (= A302)
- binding pyridoxal-5'-phosphate: R98 (= R93), R188 (= R185), K198 (= K195), Y203 (= Y200), E233 (= E231), T236 (≠ S234), M237 (= M235), L262 (= L255), G264 (= G257), V265 (≠ I258), T266 (= T259), G308 (= G300), T309 (= T301)
2abjA Crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, c16h10n2o4f3scl, and pyridoxal 5' phosphate. (see paper)
43% identity, 92% coverage: 17:343/354 of query aligns to 23:356/366 of 2abjA
- active site: K202 (= K195)
- binding n'-(5-chlorobenzofuran-2-carbonyl)-2-(trifluoromethyl)benzenesulfonohydrazide: F29 (= F23), F75 (= F69), Y141 (= Y135), Y173 (= Y167), K202 (= K195), Q224 (= Q217), T240 (≠ S234), M241 (= M235), G312 (= G300), A314 (= A302), C315 (≠ A303)
- binding pyridoxal-5'-phosphate: R99 (= R93), R192 (= R185), K202 (= K195), Y207 (= Y200), E237 (= E231), T240 (≠ S234), M241 (= M235), N242 (= N236), L266 (= L255), G268 (= G257), V269 (≠ I258), T270 (= T259), T313 (= T301)
2coiA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with gabapentin (see paper)
44% identity, 92% coverage: 18:343/354 of query aligns to 22:349/358 of 2coiA
- active site: K195 (= K195)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: Y68 (= Y64), R141 (= R137), V153 (= V149), T233 (≠ S234), G305 (= G300), T306 (= T301), A307 (= A302)
- binding pyridoxal-5'-phosphate: R97 (= R93), R185 (= R185), K195 (= K195), Y200 (= Y200), E230 (= E231), T233 (≠ S234), L259 (= L255), G261 (= G257), V262 (≠ I258), T263 (= T259), T306 (= T301)
2cogA Crystal structure of oxidized human cytosolic branched-chain aminotransferase complexed with 4-methylvalerate (see paper)
44% identity, 92% coverage: 18:343/354 of query aligns to 22:349/358 of 2cogA
- active site: K195 (= K195)
- binding 4-methyl valeric acid: Y171 (= Y167), T233 (≠ S234), T306 (= T301), A307 (= A302)
- binding pyridoxal-5'-phosphate: R97 (= R93), K195 (= K195), Y200 (= Y200), E230 (= E231), T233 (≠ S234), L259 (= L255), G261 (= G257), V262 (≠ I258), T263 (= T259), T306 (= T301)
5i5sA X-ray crystal structure at 2.06a resolution of human mitochondrial branched chain aminotransferase (bcatm) complexed with a benzisoxazole compound and an internal aldimine linked plp cofactor. (see paper)
40% identity, 96% coverage: 4:342/354 of query aligns to 7:351/361 of 5i5sA
- active site: K198 (= K195)
- binding 2-(1,2-benzoxazol-3-yl)ethanoic acid: F26 (= F23), F71 (= F69), K198 (= K195), T236 (≠ S234), T309 (= T301), A310 (= A302)
- binding pyridoxal-5'-phosphate: R95 (= R93), R188 (= R185), K198 (= K195), Y203 (= Y200), E233 (= E231), T236 (≠ S234), M237 (= M235), N238 (= N236), L262 (= L255), G264 (= G257), V265 (≠ I258), V266 (≠ T259), G308 (= G300), T309 (= T301)
Query Sequence
>WP_092053855.1 NCBI__GCF_900111775.1:WP_092053855.1
MNIDIQPLTAKKSLFEDESKLGFGNLFTDRMFLMDYDAGEGWHSPRIVPYGPLSLDPSCA
VLHYAQEIFEGLKAFRRPDGNIALFRPRDNFERFNRSAARMCMPELDVDFVLKALKTLIH
LESDWVPKSLGTSLYIRPTMIATDPYLGVHPSSKYLFYIILSPVGAYYKNGFSPVKIYIS
DGYVRSAPGGTGEAKTGGNYAASLKASMEAAALGFDQVLWLDAVERKYVEEVGSMNICFL
YDGKVVTSPLKGTILDGITRRSILALVKELGLQVEERALSVDEILEGAGNGRLKEAFGTG
TAAVVSPVGQFTYRDRTVTLGDGRMGELTGRLYDMLTGIQYGKLPDQHGWVEMI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory