Comparing WP_092056754.1 NCBI__GCF_900111775.1:WP_092056754.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7kb1C Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
52% identity, 99% coverage: 3:422/425 of query aligns to 3:423/428 of 7kb1C
7kb1A Complex of o-acety-l-homoserine aminocarboxypropyltransferase (mety) from thermotoga maritima and a key reaction intermediate (see paper)
52% identity, 99% coverage: 3:422/425 of query aligns to 3:423/428 of 7kb1A
8wkoA Crystal structure of o-acetylhomoserine sulfhydrylase from lactobacillus plantarum in the closed form
48% identity, 99% coverage: 3:422/425 of query aligns to 5:422/425 of 8wkoA
O13326 Homocysteine synthase; O-acetylhomoserine sulfhydrylase; OAH SHL; OAH sulfhydrylase; EC 2.5.1.49 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
50% identity, 95% coverage: 20:422/425 of query aligns to 22:426/429 of O13326
2ctzA Crystal structure of o-acetyl homoserine sulfhydrylase from thermus thermophilus hb8
46% identity, 98% coverage: 6:422/425 of query aligns to 2:420/421 of 2ctzA
Q5SK88 O-acetyl-L-homoserine sulfhydrylase 1; OAH-sulfhydrylase 1; EC 2.5.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
46% identity, 98% coverage: 6:422/425 of query aligns to 2:420/421 of Q5SK88
8erjB Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
44% identity, 98% coverage: 6:423/425 of query aligns to 4:424/428 of 8erjB
8erjA Crystal structure of fub7 in complex with e-2-aminocrotonate (see paper)
44% identity, 98% coverage: 6:423/425 of query aligns to 4:424/428 of 8erjA
8erbK Crystal structure of fub7 in complex with vinylglycine ketimine (see paper)
44% identity, 98% coverage: 6:423/425 of query aligns to 5:425/429 of 8erbK
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
41% identity, 99% coverage: 3:423/425 of query aligns to 4:393/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
41% identity, 99% coverage: 3:423/425 of query aligns to 4:393/396 of 3jwbA
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
41% identity, 99% coverage: 3:423/425 of query aligns to 3:392/395 of 5m3zA
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
41% identity, 99% coverage: 3:423/425 of query aligns to 4:393/396 of 6egrA
8ovhA Crystal structure of o-acetyl-l-homoserine sulfhydrolase from saccharomyces cerevisiae in complex with pyridoxal-5'-phosphate (see paper)
47% identity, 85% coverage: 60:422/425 of query aligns to 29:391/400 of 8ovhA
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
37% identity, 99% coverage: 3:423/425 of query aligns to 4:395/399 of 5dx5A
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
35% identity, 98% coverage: 9:424/425 of query aligns to 6:390/392 of 5x2xA
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
35% identity, 98% coverage: 9:424/425 of query aligns to 6:390/392 of 5x2wA
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
35% identity, 98% coverage: 9:424/425 of query aligns to 7:391/393 of 5x30C
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
35% identity, 98% coverage: 9:424/425 of query aligns to 11:395/397 of 3vk3A
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
35% identity, 98% coverage: 9:424/425 of query aligns to 12:396/398 of 1pg8A
>WP_092056754.1 NCBI__GCF_900111775.1:WP_092056754.1
MSKSWKIETQAVQGTYAPKATEARIPTICQSTTFKYDSAEHVAKLFDLDLPDPFYTRLGN
PTTDAFEGKIALMEGGVGALATSSGQAATALSIMNICRAGQHIVTAGTLYGGTYSLFANT
LPKLGIEVSFVNPDSSAEEIKKHFRPETKALFAETIGNPGLNVLDFEKFSAVARATGVPL
LIDNTFPTPYLCRPLDHGADIVIHSATKYIDGHASSLGGVIVDGGKFDWTSGKFPELTEP
DSSYHGLRYVEKFGPSAYIVKARAQYMRDLGVTPSPFNSFLFHQGLTTLPLRMERHSANA
LALAHFLQGHPKVSWVNYPGLESHPSYPLAQRYMPKGASGVLTFGIKGAREAGIRFMEAT
RIIALVVHVGDARSCVLHPASTTHRQLSEAQQIASGVTPDLIRLSVGIEHIDDLIADVEQ
ALNAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory