SitesBLAST
Comparing WP_092057383.1 NCBI__GCF_900111775.1:WP_092057383.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
30% identity, 92% coverage: 25:578/603 of query aligns to 95:639/664 of P09114
- P191 (≠ S124) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (vs. gap) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
30% identity, 92% coverage: 25:578/603 of query aligns to 98:642/667 of P09342
- C161 (= C91) modified: Disulfide link with 307
- P194 (≠ S124) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (= C243) modified: Disulfide link with 161
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (≠ F284), R292 (≠ M312), W489 (vs. gap)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), G426 (= G452), M428 (= M454), G452 (= G478), D453 (= D479), G454 (= G480), S455 (= S481), L483 (= L509), G484 (= G510), M485 (= M511), V486 (= V512)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), M263 (≠ V281), L264 (≠ Y282), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), R288 (= R308), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449)
- binding magnesium ion: A37 (= A46), T82 (= T94), S83 (≠ T95), Q122 (= Q134), Y381 (≠ K404), D453 (= D479), M458 (= M484), Q461 (= Q487), N480 (≠ D506), H482 (≠ A508), K533 (≠ L550)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/585 of 5k2oA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ F284), R292 (≠ M312), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), G286 (≠ N306), R288 (= R308), D290 (≠ G310), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), Q404 (≠ W430), M405 (≠ A431), G423 (≠ M449)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), M428 (= M454), D453 (= D479), G454 (= G480), S455 (= S481), N480 (≠ D506), H482 (≠ A508), L483 (= L509), G484 (= G510), M485 (= M511), V486 (= V512)
Sites not aligning to the query:
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), G426 (= G452), M428 (= M454), G452 (= G478), D453 (= D479), G454 (= G480), S455 (= S481), M458 (= M484), N480 (≠ D506), H482 (≠ A508), L483 (= L509), G484 (= G510), M485 (= M511), V486 (= V512)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), V287 (≠ T307), R288 (= R308), D290 (≠ G310), R292 (≠ M312), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449)
- binding magnesium ion: F370 (≠ G393), D453 (= D479), M458 (= M484), Q461 (= Q487), N480 (≠ D506), H482 (≠ A508), K533 (≠ L550)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ F284), R292 (≠ M312), M485 (= M511), W489 (vs. gap)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 5wj1A
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), M263 (≠ V281), L264 (≠ Y282), G286 (≠ N306), R288 (= R308), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449), G424 (= G450)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ F284), D291 (≠ E311), R292 (≠ M312), M485 (= M511), W489 (vs. gap)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), M428 (= M454), D453 (= D479), G454 (= G480), S455 (= S481), M458 (= M484), N480 (≠ D506), H482 (≠ A508), L483 (= L509), G484 (= G510), M485 (= M511), V486 (= V512)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 5k6tA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ A285), R292 (≠ M312), M485 (= M511), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), G286 (≠ N306), R288 (= R308), D290 (≠ G310), R292 (≠ M312), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), Q404 (≠ W430), M405 (≠ A431), G423 (≠ M449)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), G426 (= G452), M428 (= M454), G452 (= G478), G454 (= G480), S455 (= S481), N480 (≠ D506), H482 (≠ A508), L483 (= L509), G484 (= G510)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 5k6rA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ M312), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), M266 (≠ F284), G286 (≠ N306), R288 (= R308), R292 (≠ M312), V293 (≠ L314), D310 (= D331), I311 (≠ G332), G328 (= G349), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), G426 (= G452), M428 (= M454), D453 (= D479), G454 (= G480), S455 (= S481), M458 (= M484), N480 (≠ D506), H482 (≠ A508), L483 (= L509), G484 (= G510), M485 (= M511), V486 (= V512)
Sites not aligning to the query:
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/583 of 5k3sA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ M312), M485 (= M511), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), M266 (≠ F284), G286 (≠ N306), R288 (= R308), D290 (≠ G310), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), G426 (= G452), M428 (= M454), D453 (= D479), G454 (= G480), S455 (= S481), N480 (≠ D506), H482 (≠ A508), L483 (= L509), G484 (= G510), M485 (= M511), V486 (= V512)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 1z8nA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (≠ R152), R161 (≠ S178), Y191 (≠ T209), R194 (≠ Q212), D291 (≠ E311), R292 (≠ M312), D312 (≠ V333), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), G265 (= G283), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), V287 (≠ T307), R288 (= R308), D290 (≠ G310), R292 (≠ M312), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449), G424 (= G450)
- binding magnesium ion: D453 (= D479), N480 (≠ D506)
- binding thiamine diphosphate: V400 (≠ A426), G401 (= G427), Q402 (≠ N428), H403 (≠ S429), G426 (= G452), M428 (= M454), G452 (= G478), G454 (= G480), S455 (= S481), N480 (≠ D506), H482 (≠ A508), L483 (= L509), G484 (= G510), M485 (= M511), V486 (= V512)
Sites not aligning to the query:
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 1yi1A
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (≠ E311), R292 (≠ M312), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), M263 (≠ V281), L264 (≠ Y282), G265 (= G283), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), V287 (≠ T307), R288 (= R308), D290 (≠ G310), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449), G424 (= G450)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
Sites not aligning to the query:
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 1yi0A
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ E311), R292 (≠ M312), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), G265 (= G283), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), V287 (≠ T307), R288 (= R308), D290 (≠ G310), R292 (≠ M312), V293 (≠ L314), D310 (= D331), I311 (≠ G332), G328 (= G349), D329 (≠ Q350), V330 (≠ P351), M405 (≠ A431), G423 (≠ M449), G424 (= G450)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
Sites not aligning to the query:
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 1yhzA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (≠ E311), R292 (≠ M312), M485 (= M511), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), V287 (≠ T307), R288 (= R308), D290 (≠ G310), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), Q404 (≠ W430), M405 (≠ A431), G423 (≠ M449), G424 (= G450)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
Sites not aligning to the query:
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 1yhyA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (≠ E311), R292 (≠ M312), V486 (= V512), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G222 (= G240), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), G265 (= G283), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), V287 (≠ T307), R288 (= R308), D290 (≠ G310), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), Q404 (≠ W430), M405 (≠ A431), G423 (≠ M449), G424 (= G450)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
Sites not aligning to the query:
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 16:554/582 of 1ybhA
- active site: Y33 (≠ V42), G35 (= G44), G36 (= G45), A37 (= A46), S38 (≠ I47), E59 (= E71), T82 (= T94), F121 (≠ L133), Q122 (= Q134), E123 (≠ D135), K171 (≠ S187), M266 (≠ F284), V293 (≠ L314), V400 (≠ A426), G426 (= G452), M428 (= M454), D453 (= D479), N480 (≠ D506), H482 (≠ A508), L483 (= L509), M485 (= M511), V486 (= V512), W489 (vs. gap)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (≠ F284), D291 (≠ E311), R292 (≠ M312), M485 (= M511), W489 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (≠ S178), G223 (= G241), G224 (≠ A242), T246 (≠ G264), L247 (≠ P265), M248 (≠ E266), L264 (≠ Y282), M266 (≠ F284), H267 (≠ A285), G286 (≠ N306), V287 (≠ T307), R288 (= R308), D290 (≠ G310), V293 (≠ L314), D310 (= D331), I311 (≠ G332), D329 (≠ Q350), V330 (≠ P351), Q404 (≠ W430), M405 (≠ A431), G423 (≠ M449), G424 (= G450)
- binding magnesium ion: D453 (= D479), N480 (≠ D506), H482 (≠ A508)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
30% identity, 91% coverage: 25:572/603 of query aligns to 101:639/670 of P17597
- A122 (= A46) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ E48) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E71) binding
- S186 (= S113) binding
- P197 (≠ S124) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ P126) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q134) binding
- K220 (≠ R152) binding
- R246 (≠ S178) binding ; binding
- K256 (≠ S187) binding
- G308 (= G241) binding
- TL 331:332 (≠ GP 264:265) binding
- C340 (≠ P273) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ YGFA 282:285) binding
- GVRFD 371:375 (≠ NTRLG 306:310) binding
- DR 376:377 (≠ EM 311:312) binding
- DI 395:396 (≠ DG 331:332) binding
- DV 414:415 (≠ QP 350:351) binding
- QH 487:488 (≠ NS 428:429) binding
- GG 508:509 (≠ MG 449:450) binding
- GAM 511:513 (≠ GSM 452:454) binding
- D538 (= D479) binding
- DGS 538:540 (= DGS 479:481) binding
- N565 (≠ D506) binding
- NQHLGM 565:570 (≠ DRALGM 506:511) binding
- H567 (≠ A508) binding
- W574 (vs. gap) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 15:553/582 of 3ea4A
- active site: Y32 (≠ V42), G34 (= G44), G35 (= G45), A36 (= A46), S37 (≠ I47), E58 (= E71), T81 (= T94), F120 (≠ L133), Q121 (= Q134), E122 (≠ D135), K170 (≠ S187), M265 (≠ F284), V292 (≠ L314), V399 (≠ A426), G425 (= G452), M427 (= M454), D452 (= D479), N479 (≠ D506), H481 (≠ A508), L482 (= L509), M484 (= M511), V485 (= V512), W488 (vs. gap)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (≠ E311), R291 (≠ M312), W488 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (≠ S178), G221 (= G240), G222 (= G241), G223 (≠ A242), T245 (≠ G264), L246 (≠ P265), M247 (≠ E266), L263 (≠ Y282), G264 (= G283), M265 (≠ F284), H266 (≠ A285), G285 (≠ N306), R287 (= R308), D289 (≠ G310), R291 (≠ M312), D309 (= D331), I310 (≠ G332), G327 (= G349), D328 (≠ Q350), V329 (≠ P351), M404 (≠ A431), G422 (≠ M449)
- binding magnesium ion: D452 (= D479), N479 (≠ D506), H481 (≠ A508)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ A426), G400 (= G427), Q401 (≠ N428), H402 (≠ S429), M427 (= M454), G451 (= G478), D452 (= D479), G453 (= G480), S454 (= S481), N479 (≠ D506), H481 (≠ A508), L482 (= L509), G483 (= G510), M484 (= M511), V485 (= V512)
Sites not aligning to the query:
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
30% identity, 91% coverage: 25:572/603 of query aligns to 15:553/582 of 3e9yA
- active site: Y32 (≠ V42), G34 (= G44), G35 (= G45), A36 (= A46), S37 (≠ I47), E58 (= E71), T81 (= T94), F120 (≠ L133), Q121 (= Q134), E122 (≠ D135), K170 (≠ S187), M265 (≠ F284), V292 (≠ L314), V399 (≠ A426), G425 (= G452), M427 (= M454), D452 (= D479), N479 (≠ D506), H481 (≠ A508), L482 (= L509), M484 (= M511), V485 (= V512), W488 (vs. gap)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (≠ E311), R291 (≠ M312), W488 (vs. gap)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (≠ S178), G221 (= G240), G222 (= G241), G223 (≠ A242), T245 (≠ G264), L246 (≠ P265), M247 (≠ E266), L263 (≠ Y282), G285 (≠ N306), R287 (= R308), D289 (≠ G310), R291 (≠ M312), D309 (= D331), I310 (≠ G332), G327 (= G349), D328 (≠ Q350), V329 (≠ P351), M404 (≠ A431), G422 (≠ M449)
- binding magnesium ion: D452 (= D479), N479 (≠ D506), H481 (≠ A508)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (≠ A426), G400 (= G427), Q401 (≠ N428), H402 (≠ S429), M427 (= M454), G451 (= G478), G453 (= G480), S454 (= S481), N479 (≠ D506), H481 (≠ A508), L482 (= L509), G483 (= G510), M484 (= M511), V485 (= V512)
Sites not aligning to the query:
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
28% identity, 92% coverage: 24:575/603 of query aligns to 11:555/596 of 1t9cA
- active site: Y29 (≠ V42), G31 (= G44), G32 (= G45), A33 (= A46), I34 (= I47), E55 (= E71), T78 (= T94), F117 (≠ L133), Q118 (= Q134), E119 (≠ D135), K167 (≠ S187), R227 (vs. gap), M263 (≠ F284), V290 (≠ L314), V406 (≠ A426), L431 (≠ F451), G432 (= G452), M434 (= M454), D459 (= D479), N486 (≠ D506), E488 (≠ A508), Q489 (≠ L509), M491 (= M511), V492 (= V512), W495 (≠ G515), L517 (≠ I536), G522 (= G541), L523 (≠ A542)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G45), V107 (≠ T123), P108 (≠ S124), F117 (≠ L133), K167 (≠ S187), D288 (≠ E311), R289 (≠ M312), W495 (≠ G515)
- binding flavin-adenine dinucleotide: R157 (≠ S178), G216 (= G240), A217 (≠ G241), G218 (≠ A242), N221 (≠ E245), T243 (≠ G264), L244 (≠ P265), Q245 (≠ E266), L261 (≠ Y282), M263 (≠ F284), H264 (≠ A285), G283 (≠ N306), A284 (≠ T307), R285 (= R308), D287 (≠ G310), R289 (≠ M312), V290 (≠ L314), E316 (≠ T338), V317 (≠ R339), N321 (≠ S357), G334 (≠ A369), D335 (≠ E370), A336 (≠ S371), M411 (≠ A431), G429 (≠ M449), G430 (= G450)
- binding magnesium ion: D459 (= D479), N486 (≠ D506), E488 (≠ A508)
Sites not aligning to the query:
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
28% identity, 92% coverage: 24:575/603 of query aligns to 11:555/596 of 1t9dA
- active site: Y29 (≠ V42), G31 (= G44), G32 (= G45), A33 (= A46), I34 (= I47), E55 (= E71), T78 (= T94), F117 (≠ L133), Q118 (= Q134), E119 (≠ D135), K167 (≠ S187), R227 (vs. gap), M263 (≠ F284), V290 (≠ L314), V406 (≠ A426), L431 (≠ F451), G432 (= G452), M434 (= M454), D459 (= D479), N486 (≠ D506), E488 (≠ A508), Q489 (≠ L509), M491 (= M511), V492 (= V512), W495 (≠ G515), L517 (≠ I536), G522 (= G541), L523 (≠ A542)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G45), A33 (= A46), V107 (≠ T123), P108 (≠ S124), F117 (≠ L133), K167 (≠ S187), M263 (≠ F284), D288 (≠ E311), R289 (≠ M312), W495 (≠ G515)
- binding flavin-adenine dinucleotide: R157 (≠ S178), G216 (= G240), A217 (≠ G241), G218 (≠ A242), N221 (≠ E245), T243 (≠ G264), L244 (≠ P265), Q245 (≠ E266), M260 (≠ V281), L261 (≠ Y282), H264 (≠ A285), G283 (≠ N306), A284 (≠ T307), R285 (= R308), D287 (≠ G310), R289 (≠ M312), V290 (≠ L314), E316 (≠ T338), V317 (≠ R339), N321 (≠ S357), G334 (≠ A369), D335 (≠ E370), A336 (≠ S371), Q410 (≠ W430), M411 (≠ A431), G429 (≠ M449), G430 (= G450)
- binding magnesium ion: D459 (= D479), N486 (≠ D506), E488 (≠ A508)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E71), P81 (= P97), Q118 (= Q134), G432 (= G452), M434 (= M454), M464 (= M484)
Sites not aligning to the query:
Query Sequence
>WP_092057383.1 NCBI__GCF_900111775.1:WP_092057383.1
MSPIQSGPAGEQPASQSCAPPDLGDLIVSYLEELHIDYVFGVPGGAIEPFYNALARSARR
GGIRPVVARHESGAAFMADGYARETGKLGVCCATTGPGATNLITGVASAFMDSVPLLVIT
AQTSLPQFGKRALQDSSCTAVDTVGMFRHCTRYNTLISHRGQLEGKLVAAIMAAHRGSGP
AHISIPSDILREPRRIRNGADRPVAGDETLRQKFSLIDPTAVEKLRQALEKAKKMVIVIG
GACGEAMDEILAFTENTGALLISGPEGKGWIDPWHPQYRGVYGFAGHESARQALFDEEVD
LVLAVNTRLGEMLLCGGEEKRLLNDKLVHIDGVAEHFTRSPMARLHVCGQPRAVFESLNR
SLRQVRRAAESTTSLKSGPTIAGIPPHLTIEDGSTWLAADGPLKPQRVMVELAVRFPENS
RFLVDAGNSWAWATHYLHPKSAGRYRIAMGFGSMTWAIGAAIGTALGCPGNPVVCLTGDG
SFLMSGQELSVAVTEKLPVIFVLLNDRALGMVKHGQRLGGGEAIAFELPPVDFCGIARAM
GARACRIASLDDLNRLDVAEICAAPGPTLLEIHIDPEETPPMGARMKALSGKTPGVVPLW
PKS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory