Comparing WP_092057476.1 NCBI__GCF_900111775.1:WP_092057476.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
35% identity, 99% coverage: 4:796/799 of query aligns to 5:832/841 of 8g3hA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
38% identity, 70% coverage: 6:565/799 of query aligns to 9:559/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
38% identity, 70% coverage: 6:565/799 of query aligns to 9:559/559 of 1q8jA
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 99% coverage: 8:798/799 of query aligns to 12:872/1227 of P13009
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
30% identity, 99% coverage: 8:797/799 of query aligns to 26:891/1265 of Q99707
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
28% identity, 70% coverage: 8:564/799 of query aligns to 10:593/611 of 4cczA
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
44% identity, 23% coverage: 615:797/799 of query aligns to 28:214/215 of 7xcnP
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
36% identity, 32% coverage: 319:574/799 of query aligns to 12:268/271 of 2ycjA
2yciX Methyltransferase native (see paper)
36% identity, 32% coverage: 319:574/799 of query aligns to 12:268/271 of 2yciX
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
36% identity, 32% coverage: 319:574/799 of query aligns to 13:269/272 of 2yckX
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
35% identity, 32% coverage: 319:574/799 of query aligns to 3:259/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
35% identity, 32% coverage: 319:574/799 of query aligns to 3:259/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
35% identity, 32% coverage: 319:574/799 of query aligns to 3:259/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
35% identity, 32% coverage: 319:574/799 of query aligns to 3:259/262 of 2e7fA
Q46389 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase; 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase; MeTr; EC 2.1.1.258 from Moorella thermoacetica (Clostridium thermoaceticum) (see 2 papers)
35% identity, 32% coverage: 319:574/799 of query aligns to 3:259/262 of Q46389
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
38% identity, 25% coverage: 595:796/799 of query aligns to 4:206/507 of 8sseA
Sites not aligning to the query:
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
38% identity, 28% coverage: 319:544/799 of query aligns to 4:239/282 of 5vooA
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
34% identity, 26% coverage: 593:798/799 of query aligns to 9:222/577 of 3bulA
Sites not aligning to the query:
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
34% identity, 26% coverage: 593:798/799 of query aligns to 9:222/576 of 3ivaA
Sites not aligning to the query:
2i2xB Crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri (see paper)
34% identity, 26% coverage: 589:798/799 of query aligns to 26:243/258 of 2i2xB
>WP_092057476.1 NCBI__GCF_900111775.1:WP_092057476.1
MADFLQAIKEQVLVLDGAMGTMLQERGLQAGASPEAMNLEAPAVVEGVHRAYAEAGADIL
VSNTFGGSRSKLAHYGLEGRVAEINRAGVEIVRRAAGSGQFVAASIGPTGRFLQPVGDAG
FDEMVEIFGEQVQAFVAGGADLISMETFLDVRELRAAVIACREFSKLPIIAQMTFDDAGR
TVLGTPPEAAAVTLDALGADVIGSNCGLGIDGIYAILEKMRTVTSRPLIAQANAGLPQLV
DGQTVFPGTPEEMTAYHDRLIALGARVIGGCCGTTPAHIRAIRDALDGRNQRWTPPKRRG
FLSSRSAVVEIGGAAPCAIIGERINPTGKKAYSAELREGKTAYIRREAQEQTRVGAALLD
VNCGTPGVDEPAALERAVYAVSGVSSAPLVLDSSDPAALERALKAVDGKVLINSVSGEEK
SRRVILPLARKYGAAVIGLALDESGIPETAEGRTRVAGKILEAALAAGLPKEDVVIDCLT
LTVSAEQKRAMETIRALRAVRDELGLATVLGVSNISFGLPNRPVLSATFFAMALEAGLAA
AIVNPKEERMMDAFRAAMVLLGKDERAEEFIAVYGGAQAVPTVPKGEGPEPAIRELLGFA
VIEGDKDGIVALVERALGEGLSPLQISNEGLLSGLEEVGRRFGRNQIFLPQVMLSAETMQ
AAFARLKQELRGDAAQSLGKILMATVEGDIHDIGKNIVCTLLENHGFEVIDLGKNVPAAR
ILDAAQKHQVDAVGLSALMTTTLQQMEVVLGQLRAAGIKVFTMVGGAVVTQDYADAIGAD
LYAADALEAVAKVKALLAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory