Comparing WP_092348110.1 NCBI__GCF_900107645.1:WP_092348110.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
45% identity, 100% coverage: 1:461/462 of query aligns to 2:462/464 of 4f4fA
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
47% identity, 91% coverage: 1:422/462 of query aligns to 5:462/514 of Q42598
1kl7A Crystal structure of threonine synthase from yeast (see paper)
47% identity, 91% coverage: 3:422/462 of query aligns to 7:459/509 of 1kl7A
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
38% identity, 94% coverage: 3:436/462 of query aligns to 7:455/496 of 8g1yA
1vb3A Crystal structure of threonine synthase from escherichia coli
33% identity, 97% coverage: 1:449/462 of query aligns to 1:416/428 of 1vb3A
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 55% coverage: 91:342/462 of query aligns to 184:438/526 of Q9S7B5
Sites not aligning to the query:
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
24% identity, 55% coverage: 91:342/462 of query aligns to 109:363/444 of 2c2bA
Sites not aligning to the query:
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
27% identity, 44% coverage: 58:262/462 of query aligns to 5:194/350 of 2zsjA
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
24% identity, 55% coverage: 91:342/462 of query aligns to 127:365/448 of 2c2gA
>WP_092348110.1 NCBI__GCF_900107645.1:WP_092348110.1
MKYCSTRGQVQGLSFSDAVMMGLADDGGLLLPEAIPQLSKQELQSMDQLPYPDLAFKIIS
KFATDIPAAELKEIIDRSYANFDHAQITPVIKQDDLYILELFHGPTFAFKDIALQFLGNL
FEYLLTKNSQKMNIIGATSGDTGSAAIYGVRGKKNINIFILHPKGHVSPIQELQMTTVTD
ENVFNLAVEGTFDDAQSIVKEIFGDLQFKKQFSLGAVNSINWARVLAQVVYYFYAWYQVS
QETGAEQIDVSVPTGNFGDIFAGYIAKQMGVPINQLILATNANNILSRCIKSGDYSMAEV
HHSLSPSMDIQVASNFERYLYYLLDCNAQSVMQMMASFKQNGRLDFTADQKQRLKNDFST
SSINDEETLATIKSFYLENGYILDPHTAVGVAVGRKESNPQTPLVCLATAHPAKFGDTVK
KATGQDPILPEALSKLTTCEKRLTTIPAEKNQVKDYIKENAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory