Comparing WP_092348734.1 NCBI__GCF_900107645.1:WP_092348734.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
53% identity, 96% coverage: 3:210/216 of query aligns to 539:734/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 94% coverage: 1:202/216 of query aligns to 1:186/198 of P9WK95
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
32% identity, 68% coverage: 18:164/216 of query aligns to 13:141/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
32% identity, 68% coverage: 18:164/216 of query aligns to 13:141/167 of 2pkpA
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
36% identity, 31% coverage: 65:130/216 of query aligns to 644:709/780 of P20004
Sites not aligning to the query:
P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 50% coverage: 80:186/216 of query aligns to 661:785/789 of P39533
Sites not aligning to the query:
>WP_092348734.1 NCBI__GCF_900107645.1:WP_092348734.1
MEKFTQLTGLVAPLDRSNIDTDAIIPKQFLKSIKRTGFGPYLFDEWRYLDHGEPDMDCSD
RPLNPDFILNHPRYQGAQILLARDNFGCGSSREHAPWALLDYGFRVIIAPSFADIFYNNC
FKNGILPIVLDTDNIDELFTAVMDQPGYKIEVNLETTSLTSPNGKMYSFEVDPFRRHCLL
NGLDDIGLTLEKVDKITAYEDSHRLANPWLFGLNSH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory