Comparing WP_092350915.1 NCBI__GCF_900107645.1:WP_092350915.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
37% identity, 99% coverage: 3:528/531 of query aligns to 4:525/526 of 3dc2A
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
37% identity, 99% coverage: 3:528/531 of query aligns to 5:524/525 of 3ddnB
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
38% identity, 85% coverage: 2:453/531 of query aligns to 8:456/533 of O43175
Sites not aligning to the query:
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
44% identity, 58% coverage: 2:307/531 of query aligns to 4:305/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
44% identity, 57% coverage: 2:305/531 of query aligns to 4:303/306 of 7dkmA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
44% identity, 57% coverage: 2:305/531 of query aligns to 3:302/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
44% identity, 57% coverage: 2:305/531 of query aligns to 3:302/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
44% identity, 57% coverage: 2:305/531 of query aligns to 3:302/303 of 6plgA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
44% identity, 57% coverage: 2:306/531 of query aligns to 2:299/299 of 6cwaA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
44% identity, 57% coverage: 2:306/531 of query aligns to 3:300/301 of 6rj5A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
44% identity, 57% coverage: 3:305/531 of query aligns to 1:299/299 of 6rj2A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
44% identity, 56% coverage: 2:298/531 of query aligns to 2:294/297 of 6rj3A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
43% identity, 57% coverage: 2:304/531 of query aligns to 2:292/292 of 6plfB
7cvpA The crystal structure of human phgdh from biortus.
45% identity, 42% coverage: 79:303/531 of query aligns to 33:254/254 of 7cvpA
2eklA Structure of st1218 protein from sulfolobus tokodaii
37% identity, 57% coverage: 1:303/531 of query aligns to 5:304/312 of 2eklA
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
40% identity, 51% coverage: 36:307/531 of query aligns to 35:304/304 of 1wwkA
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
46% identity, 38% coverage: 100:302/531 of query aligns to 5:204/204 of 6rj6A
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
48% identity, 37% coverage: 96:290/531 of query aligns to 2:193/195 of 5ofwA
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
48% identity, 37% coverage: 96:290/531 of query aligns to 2:193/195 of 5ofvA
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
48% identity, 37% coverage: 96:290/531 of query aligns to 2:193/195 of 5ofmA
>WP_092350915.1 NCBI__GCF_900107645.1:WP_092350915.1
MKVLITDEISDNGLLPLTEDPRIHIDKKLGLSIPELHKIIGGYEAIITRSGTLVDKALLD
CADNLKIVARAGVGIDNVDVDAASSKGIIVVNAPYGNVNSAAEHTMAIMLSLFRNVPMAN
TSLKGGDWKRALFTGCELKGKTVGIIGLGKVGGRVARRCRAFEAEVITYDPYISEKRADD
FGVKLQPLEDIIRFSDVITVHTPLNDETRNIISSDSFKGMKDGVVIINCARGGIINEAAM
LEALESGKCAGAAFDVWSQEPPKTDVLQKLIAHPKMLVTPHLGANTFEAQKNVAVDVSKE
IVNYVDGRPLENAVNIPRFDPDQMEHMKPFMQLVSILGDFISQLAPPNPNKVTFTYNGQL
ARFDCAPLSVSGLAALLNHCTDQEVNMVNASLIAREMGIEVESIRSTETDSFSSLITLSL
ESAQGRRTIAGTLFEGTPKIVKMRDYAIDFRPEKDMLVINYQDRSGLIGKIGTVLGEADV
NIGNMSLGRQEKAGEAMVVFSVDSPVDEETLQKVSEAVSPKFIKAVHLDQV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory