SitesBLAST
Comparing WP_092481845.1 NCBI__GCF_900115975.1:WP_092481845.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
32% identity, 54% coverage: 58:129/133 of query aligns to 128:208/348 of 5t61L
- binding iron/sulfur cluster: I129 (= I59), I146 (= I76), C153 (= C83), C156 (= C86), C159 (= C89), C163 (= C93), P164 (= P94), I168 (≠ L98), I186 (≠ V107), C193 (= C114), H195 (≠ I116), C196 (= C117), G197 (≠ H118), C199 (= C120), C203 (= C124), P204 (= P125), I208 (≠ M129)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
8b6fAL ndutt15 (see paper)
41% identity, 38% coverage: 80:129/133 of query aligns to 115:172/218 of 8b6fAL
- binding iron/sulfur cluster: C118 (= C83), I119 (≠ V84), C121 (= C86), K122 (≠ G87), C124 (= C89), C128 (= C93), I133 (≠ L98), Y150 (≠ F109), C157 (= C114), I158 (≠ V115), Y159 (≠ I116), C160 (= C117), G161 (≠ H118), C163 (= C120), C167 (= C124), P168 (= P125), A171 (= A128), I172 (≠ M129)
Sites not aligning to the query:
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
40% identity, 39% coverage: 80:131/133 of query aligns to 6:57/102 of 8a8oD
- binding iron/sulfur cluster: C9 (= C83), I10 (≠ V84), G11 (≠ S85), C12 (= C86), G13 (= G87), C15 (= C89), C19 (= C93), P20 (= P94), S32 (≠ T106), C40 (= C114), W41 (≠ V115), D42 (≠ I116), C43 (= C117), A44 (≠ H118), C46 (= C120), C50 (= C124), I55 (≠ M129)
Sites not aligning to the query:
7arcI Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
41% identity, 38% coverage: 79:129/133 of query aligns to 96:154/199 of 7arcI
- binding iron/sulfur cluster: C100 (= C83), I101 (≠ V84), S102 (= S85), C103 (= C86), K104 (≠ G87), C106 (= C89), C110 (= C93), P111 (= P94), I115 (≠ L98), Y132 (≠ F109), C139 (= C114), I140 (≠ V115), Y141 (≠ I116), C142 (= C117), G143 (≠ H118), F144 (≠ L119), C145 (= C120), C149 (= C124), A153 (= A128), I154 (≠ M129)
- binding : R131 (= R108)
Sites not aligning to the query:
Q9VF27 NADH dehydrogenase (ubiquinone) 23 kDa subunit; EC 7.1.1.2 from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 97% coverage: 1:129/133 of query aligns to 46:172/217 of Q9VF27
Sites not aligning to the query:
- 199 G→D: Disrupts mitochondrial function and results in enlarged mitochondria. Neurons present vacuolar lesions leading to neurodegeneration in the central brain. Results in behavioral defects and shorten lifespan.
8b9zI Drosophila melanogaster complex i in the active state (dm1) (see paper)
28% identity, 97% coverage: 1:129/133 of query aligns to 15:141/186 of 8b9zI
- binding iron/sulfur cluster: H75 (≠ K54), C87 (= C83), I88 (≠ V84), A89 (≠ S85), C90 (= C86), K91 (≠ G87), C93 (= C89), C97 (= C93), P98 (= P94), Y119 (≠ F109), C126 (= C114), I127 (≠ V115), Y128 (≠ I116), C129 (= C117), G130 (≠ H118), F131 (≠ L119), C132 (= C120), C136 (= C124), A140 (= A128), I141 (≠ M129)
Sites not aligning to the query:
7z0sF Structure of the escherichia coli formate hydrogenlyase complex (anaerobic preparation, without formate dehydrogenase h) (see paper)
31% identity, 41% coverage: 78:131/133 of query aligns to 34:91/164 of 7z0sF
- binding iron/sulfur cluster: C39 (= C83), I40 (≠ V84), C42 (= C86), A43 (≠ G87), A44 (= A88), C45 (= C89), C49 (= C93), P50 (= P94), A53 (= A97), L54 (= L98), W67 (≠ V107), F69 (= F109), C74 (= C114), I75 (≠ V115), F76 (≠ I116), C77 (= C117), G78 (≠ H118), C80 (= C120), C84 (= C124), P85 (= P125), A88 (= A128), I89 (≠ M129)
Sites not aligning to the query:
8e73S8 qcr9 (see paper)
40% identity, 38% coverage: 80:129/133 of query aligns to 79:136/181 of 8e73S8
- binding iron/sulfur cluster: C82 (= C83), I83 (≠ V84), C85 (= C86), K86 (≠ G87), C88 (= C89), C92 (= C93), I97 (≠ L98), C121 (= C114), I122 (≠ V115), Y123 (≠ I116), C124 (= C117), G125 (≠ H118), F126 (≠ L119), C127 (= C120), C131 (= C124), P132 (= P125), A135 (= A128), I136 (≠ M129)
Sites not aligning to the query:
6u8yN Structure of the membrane-bound sulfane sulfur reductase (mbs), an archaeal respiratory membrane complex (see paper)
30% identity, 57% coverage: 54:129/133 of query aligns to 17:101/176 of 6u8yN
- binding iron/sulfur cluster: H49 (vs. gap), C56 (= C83), I57 (≠ V84), G58 (≠ S85), C59 (= C86), M61 (≠ A88), C62 (= C89), C66 (= C93), P67 (= P94), I71 (≠ L98), M73 (vs. gap), C86 (= C114), T87 (≠ V115), C89 (= C117), Q90 (≠ H118), F91 (≠ L119), C92 (= C120), C96 (= C124), L101 (≠ M129)
7bkcK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (dimeric, composite structure) (see paper)
35% identity, 38% coverage: 75:125/133 of query aligns to 207:268/321 of 7bkcK
- binding iron/sulfur cluster: I208 (= I76), C215 (= C83), P216 (≠ V84), C219 (= C86), T221 (≠ A88), C222 (= C89), C226 (= C93), C257 (= C114), I258 (≠ V115), L259 (≠ I116), C260 (= C117), G261 (≠ H118), C263 (= C120), C267 (= C124), P268 (= P125)
Sites not aligning to the query:
- binding iron/sulfur cluster: 36, 37, 39, 42, 46, 47, 51, 77, 78, 79, 80, 81, 83, 87, 92, 119, 124, 125, 127, 130, 134, 135, 139, 178, 183, 184, 185, 186, 187, 189, 193, 194, 198
7ak5I Cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a (see paper)
40% identity, 38% coverage: 80:129/133 of query aligns to 76:133/178 of 7ak5I
- binding iron/sulfur cluster: C79 (= C83), I80 (≠ V84), A81 (≠ S85), C82 (= C86), K83 (≠ G87), C85 (= C89), C89 (= C93), C118 (= C114), I119 (≠ V115), Y120 (≠ I116), C121 (= C117), G122 (≠ H118), C124 (= C120), C128 (= C124), I133 (≠ M129)
Sites not aligning to the query:
8e9iI Mycobacterial respiratory complex i, semi-inserted quinone (see paper)
35% identity, 37% coverage: 81:129/133 of query aligns to 50:112/166 of 8e9iI
- binding iron/sulfur cluster: C52 (= C83), I53 (≠ V84), G54 (≠ S85), C55 (= C86), E56 (≠ G87), L57 (≠ A88), C58 (= C89), C62 (= C93), I67 (≠ L98), Y90 (vs. gap), C97 (= C114), I98 (≠ V115), G99 (≠ I116), C100 (= C117), G101 (≠ H118), C103 (= C120), C107 (= C124), P108 (= P125)
Sites not aligning to the query:
7bkbK Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
35% identity, 38% coverage: 75:125/133 of query aligns to 272:333/386 of 7bkbK
- binding iron/sulfur cluster: I273 (= I76), C280 (= C83), P281 (≠ V84), C284 (= C86), T286 (≠ A88), C287 (= C89), C291 (= C93), C322 (= C114), I323 (≠ V115), L324 (≠ I116), C325 (= C117), G326 (≠ H118), C328 (= C120), C332 (= C124), P333 (= P125)
Sites not aligning to the query:
- binding iron/sulfur cluster: 36, 37, 39, 42, 46, 47, 51, 77, 78, 79, 80, 81, 83, 87, 92, 119, 124, 125, 127, 130, 134, 139, 173, 174, 175, 176, 179, 183, 186, 211, 212, 214, 215, 217, 221, 222, 241, 248, 249, 251, 254, 258, 259, 263, 265
7np8B Crystal structure of the coenzyme f420-dependent sulfite reductase from methanocaldococcus jannaschii at 2.3-a resolution (see paper)
43% identity, 41% coverage: 79:132/133 of query aligns to 491:542/620 of 7np8B
- binding iron/sulfur cluster: C495 (= C83), N496 (≠ V84), G497 (≠ S85), C498 (= C86), G499 (= G87), C501 (= C89), C505 (= C93), I510 (= I100), S517 (≠ V107), C524 (= C114), V525 (= V115), G526 (≠ I116), C527 (= C117), G528 (≠ H118), C530 (= C120), C534 (= C124), N536 (≠ M126), A538 (= A128), R539 (≠ M129)
- binding siroheme: K506 (≠ P94)
Sites not aligning to the query:
- binding calcium ion: 85, 228, 273
- binding flavin-adenine dinucleotide: 83, 84, 85, 87, 88, 89, 90, 107, 108, 129, 130, 131, 132, 133, 134, 137, 156, 199, 200, 202, 271, 272, 273, 281
- binding iron/sulfur cluster: 6, 15, 16, 17, 18, 19, 21, 25, 26, 29, 30, 36, 42, 44, 46, 48, 50, 54, 55, 159, 160, 180, 201, 202, 203, 204, 256, 259, 315, 428, 434, 436, 437, 467, 468, 470, 472, 488
- binding sulfite ion: 355, 423, 460, 462
- binding siroheme: 355, 384, 386, 387, 388, 392, 429, 434, 459, 460, 462, 470, 472, 474, 553, 554, 555, 556, 594
5gupH structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
38% identity, 38% coverage: 80:129/133 of query aligns to 74:131/176 of 5gupH
- binding iron/sulfur cluster: C77 (= C83), I78 (≠ V84), A79 (≠ S85), C80 (= C86), K81 (≠ G87), C83 (= C89), C87 (= C93), C116 (= C114), I117 (≠ V115), Y118 (≠ I116), C119 (= C117), G120 (≠ H118), F121 (≠ L119), C122 (= C120), C126 (= C124), P127 (= P125), A130 (= A128), I131 (≠ M129)
- binding : R108 (= R108)
Sites not aligning to the query:
7p63I Complex i from e. Coli, ddm/lmng-purified, under turnover at ph 6, closed state (see paper)
31% identity, 40% coverage: 79:131/133 of query aligns to 56:116/180 of 7p63I
- binding iron/sulfur cluster: C60 (= C83), V61 (= V84), A62 (≠ S85), C63 (= C86), N64 (≠ G87), C66 (= C89), C70 (= C93), C74 (≠ A97), I75 (≠ L98), F92 (≠ V107), C99 (= C114), I100 (≠ V115), F101 (≠ I116), C102 (= C117), G103 (≠ H118), L104 (= L119), C105 (= C120), C109 (= C124), P110 (= P125), T111 (≠ M126), I114 (≠ M129)
Sites not aligning to the query:
8iufS8 ndufv2 (see paper)
37% identity, 38% coverage: 79:129/133 of query aligns to 71:129/182 of 8iufS8
- binding iron/sulfur cluster: C75 (= C83), I76 (≠ V84), T77 (≠ S85), C78 (= C86), Q79 (≠ G87), C81 (= C89), C85 (= C93), P86 (= P94), I90 (≠ L98), C114 (= C114), I115 (≠ V115), Y116 (≠ I116), C117 (= C117), G118 (≠ H118), C120 (= C120), C124 (= C124), I129 (≠ M129)
Sites not aligning to the query:
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
37% identity, 39% coverage: 79:130/133 of query aligns to 563:613/613 of 7p8nB
- binding iron/sulfur cluster: C567 (= C83), C570 (= C86), G571 (= G87), C573 (= C89), C577 (= C93), Y590 (≠ V107), I592 (≠ F109), C597 (= C114), K599 (≠ I116), C600 (= C117), G601 (≠ H118), C603 (= C120), C607 (= C124)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36, 67, 68, 69, 70, 71
- binding flavin mononucleotide: 185, 186, 187, 213, 215, 216, 217, 301, 304, 305, 306, 340, 341, 521, 522
- binding iron/sulfur cluster: 320, 473, 474, 475, 476, 477, 480, 519, 520, 522, 523, 560
- binding zinc ion: 457, 544, 549, 554
6cfwN Cryoem structure of a respiratory membrane-bound hydrogenase (see paper)
34% identity, 43% coverage: 75:131/133 of query aligns to 37:93/121 of 6cfwN
- binding iron/sulfur cluster: C45 (= C83), G47 (≠ S85), C48 (= C86), M50 (≠ A88), C51 (= C89), C55 (= C93), C76 (= C114), M78 (≠ I116), C79 (= C117), C82 (= C120), C86 (= C124)
7b0nI 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
33% identity, 39% coverage: 78:129/133 of query aligns to 87:146/191 of 7b0nI
- binding iron/sulfur cluster: C92 (= C83), I93 (≠ V84), A94 (≠ S85), C95 (= C86), K96 (≠ G87), C98 (= C89), C102 (= C93), C131 (= C114), I132 (≠ V115), Y133 (≠ I116), C134 (= C117), G135 (≠ H118), C137 (= C120), C141 (= C124)
Sites not aligning to the query:
Query Sequence
>WP_092481845.1 NCBI__GCF_900115975.1:WP_092481845.1
MSTKKVVLRFGADIADKPVIYKLVKDYDLVINILKANVNPQKEGTMVLDIAGEKADRGID
YLRQLGVRVQSLTEEITQNEEKCVSCGACTDICPSGALYIDRPDMTVRFDSDRCVICHLC
VKACPMRAMEVRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory