Comparing WP_092481851.1 NCBI__GCF_900115975.1:WP_092481851.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
45% identity, 85% coverage: 4:259/300 of query aligns to 12:263/295 of 6cyzA
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
32% identity, 95% coverage: 2:285/300 of query aligns to 3:296/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
32% identity, 95% coverage: 2:285/300 of query aligns to 3:296/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
32% identity, 95% coverage: 2:285/300 of query aligns to 3:296/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
32% identity, 95% coverage: 2:285/300 of query aligns to 3:296/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
32% identity, 95% coverage: 2:285/300 of query aligns to 3:296/296 of 1fwkA
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
30% identity, 87% coverage: 1:261/300 of query aligns to 1:271/310 of P00547
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 93% coverage: 2:279/300 of query aligns to 54:346/370 of Q8L7R2
Sites not aligning to the query:
3pygA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with adp
28% identity, 86% coverage: 39:295/300 of query aligns to 49:295/298 of 3pygA
Sites not aligning to the query:
3pyfA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp
28% identity, 86% coverage: 39:295/300 of query aligns to 48:294/296 of 3pyfA
Sites not aligning to the query:
3pyeA Mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with cdpme
28% identity, 86% coverage: 39:295/300 of query aligns to 52:298/301 of 3pyeA
Sites not aligning to the query:
4dxlA Crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abscessus, bound to cmp and atp (see paper)
27% identity, 85% coverage: 39:292/300 of query aligns to 56:298/304 of 4dxlA
Sites not aligning to the query:
6mdeA Mevalonate kinase from methanosarcina mazei with mevalonate bound (see paper)
25% identity, 59% coverage: 76:253/300 of query aligns to 78:261/302 of 6mdeA
Sites not aligning to the query:
6mdfA Mevalonate kinase from methanosarcina mazei with 5-phosphomevalonate bound (see paper)
25% identity, 59% coverage: 76:253/300 of query aligns to 79:262/303 of 6mdfA
Sites not aligning to the query:
4hacA Crystal structure of the mevalonate kinase from an archaeon methanosarcina mazei (see paper)
25% identity, 59% coverage: 76:253/300 of query aligns to 88:271/312 of 4hacA
Sites not aligning to the query:
>WP_092481851.1 NCBI__GCF_900115975.1:WP_092481851.1
MIRVQVPATTANLGPGFDCLGMALELYNIVEFSKISRGLVIEVEGDGAEELPRNEKNLVY
RAARRVFERACRVPEGLRIKLVNNIPVGRGLGSSASAIVGGIIAANVMCGANLSMREMLN
LACSMEGHPDNIAPALLGGLIIYTSVEGEITWTKIDLPPALKAVVAIPDFIMNTRDTREA
LPQLVTMRDAVYNIGRAALLVAALQKGDLSILGTAMDDRLHQPYRQGAIPGFKKVISAAR
LAGARGVALSGAGPTIVALADGNFELIAEVMKNTFRECGVGARTMILAPGPVGARALEVI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory