SitesBLAST
Comparing WP_092483748.1 NCBI__GCF_900115975.1:WP_092483748.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
51% identity, 99% coverage: 1:322/325 of query aligns to 64:391/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L117), R200 (= R135), M281 (≠ R212), G282 (= G213), R307 (= R238), A308 (= A239), Q320 (= Q251), V321 (= V252), G322 (= G253), Q323 (= Q254), T324 (= T255), G337 (= G268), I338 (= I269), S339 (= S270), Q343 (= Q274), H344 (= H275), N358 (= N289), K359 (= K290), L377 (= L308)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
44% identity, 98% coverage: 3:320/325 of query aligns to 11:333/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L117), R144 (= R135), I155 (≠ A146), G224 (= G211), R225 (= R212), G226 (= G213), S250 (= S237), R251 (= R238), A252 (= A239), Q264 (= Q251), V265 (= V252), G266 (= G253), Q267 (= Q254), S268 (≠ T255), G281 (= G268), I282 (= I269), S283 (= S270), S285 (≠ A272), Q287 (= Q274), H288 (= H275), N302 (= N289), K303 (= K290), D320 (= D307), A321 (≠ L308)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
46% identity, 97% coverage: 5:319/325 of query aligns to 4:324/331 of 5ol2A
- binding calcium ion: E75 (≠ D76), D188 (≠ P179)
- binding flavin-adenine dinucleotide: T117 (≠ M118), R136 (= R135), I147 (≠ A146), G216 (= G211), R217 (= R212), G218 (= G213), S242 (= S237), R243 (= R238), A244 (= A239), Q256 (= Q251), V257 (= V252), G258 (= G253), T260 (= T255), G273 (= G268), I274 (= I269), S275 (= S270), A277 (= A272), Q279 (= Q274), H280 (= H275), N294 (= N289), K295 (= K290), D312 (= D307), V313 (≠ L308)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
45% identity, 99% coverage: 3:323/325 of query aligns to 5:331/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (≠ M118), R140 (= R135), T142 (≠ I137), G219 (= G211), K220 (≠ R212), G221 (= G213), S245 (= S237), R246 (= R238), A247 (= A239), Q259 (= Q251), V260 (= V252), G261 (= G253), Q262 (= Q254), T263 (= T255), G276 (= G268), S278 (= S270), Q282 (= Q274), H283 (= H275), N297 (= N289), I298 (≠ K290), L316 (= L308)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
43% identity, 97% coverage: 7:321/325 of query aligns to 24:332/333 of P13804
- G116 (= G102) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (≠ N161) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R212) binding FAD
- S248 (= S237) binding FAD
- R249 (= R238) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 252:255) binding FAD
- T266 (= T255) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 270:275) binding FAD
- N300 (= N289) binding FAD
- DL 318:319 (= DL 307:308) binding FAD
Sites not aligning to the query:
- 20:204 Domain I
- 205:333 Domain II
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
43% identity, 97% coverage: 7:321/325 of query aligns to 6:314/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G211), R205 (= R212), S230 (= S237), R231 (= R238), A232 (= A239), Q244 (= Q251), V245 (= V252), G246 (= G253), T248 (= T255), G261 (= G268), I262 (= I269), S263 (= S270), A265 (= A272), Q267 (= Q274), H268 (= H275), N282 (= N289), K283 (= K290), D300 (= D307), L301 (= L308)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
36% identity, 97% coverage: 1:315/325 of query aligns to 9:327/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L117), T126 (≠ M118), R144 (= R135), I155 (≠ A146), R224 (= R212), G225 (= G213), T249 (≠ S237), R250 (= R238), Q263 (= Q251), I264 (≠ V252), G265 (= G253), L266 (≠ Q254), S267 (≠ T255), G280 (= G268), I281 (= I269), S282 (= S270), Q286 (= Q274), N301 (= N289), S302 (≠ K290), D303 (= D291), D319 (= D307), L320 (= L308)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
50% identity, 68% coverage: 98:319/325 of query aligns to 90:307/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G211), R200 (= R212), G201 (= G213), S225 (= S237), R226 (= R238), A227 (= A239), Q239 (= Q251), V240 (= V252), G241 (= G253), T243 (= T255), G256 (= G268), I257 (= I269), S258 (= S270), A260 (= A272), Q262 (= Q274), H263 (= H275), N277 (= N289), K278 (= K290), D295 (= D307), L296 (= L308)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
41% identity, 74% coverage: 82:320/325 of query aligns to 60:292/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G211), R184 (= R212), G185 (= G213), S209 (= S237), R210 (= R238), Q223 (= Q251), I224 (≠ V252), G225 (= G253), T227 (= T255), G240 (= G268), V241 (≠ I269), S242 (= S270), A244 (= A272), Q246 (= Q274), H247 (= H275), N261 (= N289), K262 (= K290), D279 (= D307), Y280 (≠ L308)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
35% identity, 100% coverage: 1:325/325 of query aligns to 1:321/321 of P53571
- M1 (= M1) modified: Initiator methionine, Removed
- R211 (= R212) binding FAD
- SR 236:237 (= SR 237:238) binding FAD
- QVGQS 250:254 (≠ QVGQT 251:255) binding FAD
- 268:275 (vs. 268:275, 88% identical) binding FAD
- N289 (= N289) binding FAD
- DI 307:308 (≠ DL 307:308) binding FAD
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
34% identity, 98% coverage: 5:324/325 of query aligns to 3:319/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G211), R210 (= R212), G211 (= G213), S235 (= S237), A236 (≠ R238), P237 (≠ A239), Q249 (= Q251), V250 (= V252), G251 (= G253), Q252 (= Q254), S253 (≠ T255), G267 (= G268), I268 (= I269), S269 (= S270), S271 (≠ A272), Q273 (= Q274), H274 (= H275), N288 (= N289), T289 (≠ K290), D306 (= D307), I307 (≠ L308)
Query Sequence
>WP_092483748.1 NCBI__GCF_900115975.1:WP_092483748.1
MAKGIWVFAEQRDGQIKKVTFELLSEGRKIADQLGEELGAVLLGNGVADLAASLGEYGAD
KVYVADSDALENYTTDGYTNVIADLVKQYAPSVLLMGCTVTGRDLAAQVAQRLETGLMTD
CTGMEIADGQLVFTRPIYAGKAIVKAACPEARPVMATIRPNTFAVQAGAKEAEIINVTPN
TGNIRQVIKDIVRQVSERPELTEADIIVSGGRGMKGPENFKLLEELADVLGAAVGASRAA
VDAGWIPQSFQVGQTGKTVSPVLYIACGISGAIQHLAGMSSAKCIVAINKDEEANIFKVA
DYGIVGDLFEVVPILKEELKKVLAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory