Comparing WP_092992268.1 NCBI__GCF_900102855.1:WP_092992268.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
48% identity, 99% coverage: 3:290/290 of query aligns to 5:292/293 of 4wjiA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
40% identity, 97% coverage: 2:281/290 of query aligns to 13:290/293 of 3gggD
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
40% identity, 97% coverage: 2:281/290 of query aligns to 5:282/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
40% identity, 97% coverage: 2:281/290 of query aligns to 5:282/286 of 3ggpA
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
35% identity, 98% coverage: 1:284/290 of query aligns to 8:290/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
35% identity, 97% coverage: 3:284/290 of query aligns to 2:282/365 of 6u60B
Sites not aligning to the query:
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
30% identity, 98% coverage: 4:286/290 of query aligns to 2:279/279 of 2f1kA
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
31% identity, 96% coverage: 3:281/290 of query aligns to 7:282/286 of 3b1fA
>WP_092992268.1 NCBI__GCF_900102855.1:WP_092992268.1
MVRRLAIIGVGLIGGSLARALRVAGGVGEIVGCGRDEGQLVRAVELGIIDRYSTDPAEAV
GGADGVVIGTPVGAMESILEAIRPHLADGAIITDVGSTKGSVVAAAHRVFGSRCPPGFVP
GHPIAGTERNGVEASFAELFQRRRVILTPLPESDAGATAAVRAMWEKTGAVVETMTPQHH
DEVFAATSHLPHLLAYSLVNTLATLDEKVEIFRYAAGGFRDFTRIASSNPRMWHDISLAN
RDALLKVMDRFEGDLHQMRQAIEAGDGDYLLEVFTRAKEARDCFVDKAEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory