Comparing WP_092999081.1 NCBI__GCF_900102855.1:WP_092999081.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
35% identity, 50% coverage: 109:225/232 of query aligns to 69:183/190 of 5u2kA
3nz2C Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
33% identity, 48% coverage: 115:225/232 of query aligns to 66:180/183 of 3nz2C
3nz2J Crystal structure of hexapeptide-repeat containing-acetyltransferase vca0836 complexed with acetyl co enzyme a from vibrio cholerae o1 biovar eltor
33% identity, 48% coverage: 115:225/232 of query aligns to 69:183/185 of 3nz2J
3ectA Crystal structure of the hexapeptide-repeat containing- acetyltransferase vca0836 from vibrio cholerae
33% identity, 48% coverage: 115:225/232 of query aligns to 59:173/176 of 3ectA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
36% identity, 41% coverage: 135:228/232 of query aligns to 95:186/186 of 4isxA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
47% identity, 25% coverage: 173:231/232 of query aligns to 113:169/211 of 4hurA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
47% identity, 25% coverage: 173:231/232 of query aligns to 113:169/203 of 6x3cE
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
47% identity, 25% coverage: 173:231/232 of query aligns to 113:169/212 of 4husA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
47% identity, 25% coverage: 173:231/232 of query aligns to 113:169/206 of 6x3jA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
47% identity, 25% coverage: 173:231/232 of query aligns to 113:169/207 of 6x3cA
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
37% identity, 39% coverage: 135:225/232 of query aligns to 95:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
37% identity, 39% coverage: 135:225/232 of query aligns to 95:183/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 39% coverage: 135:225/232 of query aligns to 96:184/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
37% identity, 39% coverage: 135:225/232 of query aligns to 95:183/200 of 1krrA
Sites not aligning to the query:
A1ADJ6 Polysialic acid O-acetyltransferase; Capsule O-acetyl transferase; EC 2.3.1.136 from Escherichia coli O1:K1 / APEC (see paper)
30% identity, 51% coverage: 106:224/232 of query aligns to 160:278/307 of A1ADJ6
6u9cA The 2.2 a crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with acetyl coa
36% identity, 45% coverage: 123:226/232 of query aligns to 58:162/206 of 6u9cA
6pubA Crystal structure of the type b chloramphenicol acetyltransferase from vibrio cholerae in the complex with crystal violet
36% identity, 45% coverage: 123:226/232 of query aligns to 61:165/210 of 6pubA
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
40% identity, 32% coverage: 152:226/232 of query aligns to 99:167/203 of 3dhoA
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
40% identity, 32% coverage: 152:226/232 of query aligns to 99:167/205 of 1kk4A
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
40% identity, 32% coverage: 152:226/232 of query aligns to 99:167/204 of 1mrlA
Sites not aligning to the query:
>WP_092999081.1 NCBI__GCF_900102855.1:WP_092999081.1
MAQRAAKIFRGPSYKLDTNVTVTALMGFTIRRAISLLRCILRGLALKPGKWFFVGTSVVL
RNRSFIRFGRGATIGNFVLIDGLSRNGVVIGDGVNIGAYTIIEATGVISNLGVGCRIGVN
SGIGAFSFIGAAGGVDIGNNVIMGQYVSFHSENHCFEDTERPIRMQGVTRQGIVIEDDCW
IGAKVTFLDGCHIGRGSVIAAGAVVRGSIPPYSVAVGVPAKVIKSRQRYRDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory