Comparing WP_093392506.1 NCBI__GCF_900114975.1:WP_093392506.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 78% coverage: 26:238/273 of query aligns to 27:244/271 of Q9M8S8
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
27% identity, 91% coverage: 9:256/273 of query aligns to 9:247/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
27% identity, 91% coverage: 9:256/273 of query aligns to 11:249/277 of P20456
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 9:247/274 of 4as5A
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
26% identity, 91% coverage: 9:256/273 of query aligns to 11:249/277 of P29218
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 11:249/277 of O55023
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 7:245/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 7:245/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
26% identity, 91% coverage: 9:256/273 of query aligns to 7:245/272 of 1awbA
6giuA Human impase with l-690330 (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 9:247/275 of 6giuA
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 7:245/266 of 1imdA
6zk0AAA human impase with ebselen (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 8:246/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
26% identity, 91% coverage: 9:256/273 of query aligns to 9:247/274 of 4as4A
2p3nA Thermotoga maritima impase tm1415 (see paper)
30% identity, 75% coverage: 37:242/273 of query aligns to 35:229/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
30% identity, 75% coverage: 37:242/273 of query aligns to 35:229/256 of O33832
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
26% identity, 92% coverage: 11:260/273 of query aligns to 24:271/288 of O14732
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
27% identity, 85% coverage: 30:260/273 of query aligns to 26:248/259 of 2cziA
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 79% coverage: 13:229/273 of query aligns to 93:304/346 of Q6NPM8
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
35% identity, 73% coverage: 33:232/273 of query aligns to 30:228/255 of 5yhtA
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 73% coverage: 33:232/273 of query aligns to 33:231/260 of P95189
>WP_093392506.1 NCBI__GCF_900114975.1:WP_093392506.1
MITVEDERYLVDLCEEAAEAIMSYYRGTYETTTKEDRSPLTEADRASHRLIVSALKKRWP
DIPVVSEEGLLVDFGKRKAWNYFWLVDPLDGTKEFIHGDDEFTVNIALIEGTKPFFGIVY
VPVTKRAYIGHRERGAYLIQNGSKIPLRASSNWHKERFKVAVSRSHLDSHTRAFLEHFKD
LCEPVVRGSSLKFCSVAEGSVDFYLRFGPTWEWDTAAGQAVVEAAGGSVLTIPSDKDLTY
NKPDLKNGPFIVLSGREAYLKSPFRKWIGSREL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory