Comparing WP_093395059.1 NCBI__GCF_900114975.1:WP_093395059.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
38% identity, 97% coverage: 7:412/417 of query aligns to 2:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
38% identity, 97% coverage: 7:412/417 of query aligns to 2:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
33% identity, 94% coverage: 7:398/417 of query aligns to 8:393/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 95% coverage: 14:411/417 of query aligns to 22:448/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 95% coverage: 14:411/417 of query aligns to 21:447/455 of 5j7iC
>WP_093395059.1 NCBI__GCF_900114975.1:WP_093395059.1
MSWKTILEEIGRRAKRASYLMAKATTDQKNNALAAIAEGLRRERGRIEEANRKDVEQARE
SGISGAKLDRLILSEKVMSEMVAGIEEVIAWPDPVGKITGLWKRPNGLKVGRMRIPLGVI
GIIYESRPNVTVDASILCIKSGNAVVLRGGSEAFYSNQCLVGIMREGLRKAELPEDAVQL
VPTTEREAVLEMLKLEEYVDVMIPRGGEELIRFVSENARMPVLKHYKGVCHVYVDKFADL
SMAETVCVNAKVQRPGVCNAMETLLVHRDLAGKFLPRMKEVFDSHGVELRGCPRTREIIP
CREATEEDWKAEYLDLILAVKVVDSMNEAIDHIHTYGSAHTEAIITENYERAWAFIESVQ
SSLVLVNASTRFNDGYQLGLGAEIGISTSKLHAFGPMGVDELTTTKFIAFGNGQIRT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory