Comparing WP_093427016.1 NCBI__GCF_900112605.1:WP_093427016.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
71% identity, 96% coverage: 15:394/397 of query aligns to 1:380/380 of 2x5dD
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
38% identity, 96% coverage: 8:388/397 of query aligns to 9:386/393 of 6l1nA
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
37% identity, 96% coverage: 8:388/397 of query aligns to 9:387/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
37% identity, 96% coverage: 8:388/397 of query aligns to 9:387/392 of 6l1oB
2o1bA Structure of aminotransferase from staphylococcus aureus
32% identity, 88% coverage: 33:381/397 of query aligns to 21:364/376 of 2o1bA
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
32% identity, 93% coverage: 22:391/397 of query aligns to 20:370/370 of Q58097
1j32A Aspartate aminotransferase from phormidium lapideum
33% identity, 92% coverage: 7:370/397 of query aligns to 6:365/388 of 1j32A
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
28% identity, 96% coverage: 8:390/397 of query aligns to 5:393/393 of 3jtxB
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
30% identity, 95% coverage: 7:382/397 of query aligns to 7:375/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
30% identity, 95% coverage: 7:382/397 of query aligns to 7:375/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
30% identity, 95% coverage: 7:382/397 of query aligns to 7:375/385 of Q56232
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 89% coverage: 31:382/397 of query aligns to 25:375/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
29% identity, 89% coverage: 31:382/397 of query aligns to 25:375/388 of 1gd9A
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
30% identity, 95% coverage: 7:382/397 of query aligns to 7:375/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
30% identity, 95% coverage: 7:382/397 of query aligns to 7:375/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
30% identity, 95% coverage: 7:382/397 of query aligns to 7:375/382 of 1gc3A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
28% identity, 93% coverage: 21:389/397 of query aligns to 24:382/384 of 1o4sB
2o0rA The three-dimensional structure of n-succinyldiaminopimelate aminotransferase from mycobacterium tuberculosis (see paper)
32% identity, 95% coverage: 8:383/397 of query aligns to 3:378/385 of 2o0rA
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 92% coverage: 22:385/397 of query aligns to 27:402/410 of P58350
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
28% identity, 92% coverage: 22:385/397 of query aligns to 17:392/400 of 6f35A
>WP_093427016.1 NCBI__GCF_900112605.1:WP_093427016.1
MNEEFPRIKRLPPYVFNIVNDLKAKARARGEDIVDFGMGNPDQPTPRHIVDKLVEAAQRN
NTHRYSVSRGIPRLRRAISQWYADRYDVAIDPENEAIVTIGSKEGLAHLALSVLEQGDTV
LVPNPAYPIHPYGVVIAGADIRHVPLVPDVDFFAELERAIKEAWPRPKMLILNFPGNPTT
QCVDLDFFEHVVAMAREYGIWVVHDIAYAEITFDGYEAPSILQVPGAKEVAVEFYSLSKT
YNMPGWRVGFMCGNDKLVAALARMKSYLDYGTFTPIQVAAIHALEGPQECKEEIRAMYER
RRDHLVSGLRGAGWEVESPRATMFVWAPIPEAYRHLGSLEFSKKLLQDAKVAVSPGIGFG
EYGDDHVRFSLIENEHRTRQAVRGIRDMFRRDGVAQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory