Comparing WP_093427366.1 NCBI__GCF_900112605.1:WP_093427366.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
63% identity, 98% coverage: 1:388/395 of query aligns to 1:386/391 of 8wkjA
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
52% identity, 97% coverage: 5:388/395 of query aligns to 4:392/400 of Q02635
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
52% identity, 97% coverage: 5:388/395 of query aligns to 3:391/399 of 6f77A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
49% identity, 97% coverage: 6:389/395 of query aligns to 15:403/410 of P58350
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
49% identity, 97% coverage: 6:389/395 of query aligns to 5:393/400 of 6f35A
1j32A Aspartate aminotransferase from phormidium lapideum
45% identity, 99% coverage: 3:392/395 of query aligns to 1:384/388 of 1j32A
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
47% identity, 99% coverage: 5:394/395 of query aligns to 4:384/385 of Q56232
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
47% identity, 98% coverage: 5:392/395 of query aligns to 4:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
47% identity, 98% coverage: 5:392/395 of query aligns to 4:382/382 of 1bjwA
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
46% identity, 98% coverage: 5:392/395 of query aligns to 4:382/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
46% identity, 98% coverage: 5:392/395 of query aligns to 4:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
46% identity, 98% coverage: 5:392/395 of query aligns to 4:382/382 of 1gc3A
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
43% identity, 98% coverage: 5:392/395 of query aligns to 2:396/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
42% identity, 99% coverage: 3:392/395 of query aligns to 1:397/404 of 5wmlA
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
42% identity, 99% coverage: 3:392/395 of query aligns to 1:396/402 of 5wmiA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
40% identity, 98% coverage: 5:393/395 of query aligns to 10:383/384 of 1o4sB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
39% identity, 92% coverage: 29:392/395 of query aligns to 21:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
39% identity, 92% coverage: 29:392/395 of query aligns to 21:382/388 of 1gd9A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
31% identity, 90% coverage: 34:388/395 of query aligns to 37:391/402 of P14909
Sites not aligning to the query:
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
31% identity, 99% coverage: 5:394/395 of query aligns to 2:370/370 of Q58097
>WP_093427366.1 NCBI__GCF_900112605.1:WP_093427366.1
MDIELAERARRVKPSPTLAVTARAKALRAAGQDIIGLGAGEPDFDTPETIKEAAIAAIRA
GDTKYTAVDGTPALKEAVAAKFRRDNNLDYDLDQILVSAGGKQSFFNLCQALLNPGDEVV
IPAPYWVSYPDIVRLAEGEARFVETSLDAGFKMTPDQLEAAITDRTRLVIINSPSNPTGV
AYSREELAALGAVLERHPGVLVATDDIYEHIRWEAGAFINIVNAAPALKDRAVVLNGVSK
AYSMTGWRIGYAAGPADLIAAMKTIQSQSTSNPASISQAAAVEALTGDQSCIETMVTAFK
QRHDFVVDALGQLPGVRPLPGQGAFYCFPDMSEAIQRLGLADDVAFAEHLLTEAGVALVP
GSAFGAPGCMRLSFATSLSNLEQAMERLAGVLGKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory