Comparing WP_094573762.1 NCBI__GCF_002252475.1:WP_094573762.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 89% coverage: 28:297/305 of query aligns to 13:277/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
26% identity, 85% coverage: 22:281/305 of query aligns to 27:288/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
26% identity, 81% coverage: 58:304/305 of query aligns to 251:514/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
27% identity, 66% coverage: 58:259/305 of query aligns to 236:444/490 of 4ki0F
>WP_094573762.1 NCBI__GCF_002252475.1:WP_094573762.1
MPSDNVAVTGTKSRFASRSRRSIRTGPLLAPAVIVLLLWMIVPLAMTLWFSFQYYNLINP
FVTGFAGVSNYSFLLSDPGLWSAIANTLILLGSVLAISIVLGVLFAVIFDQDFFGKNVAR
LLVIAPFFVMPTVSALIWKNLLMHPVNGFFAFISRSFGLPVIDWFSQFPMTSIIMIVSWQ
WVPFATLILMTAMQSLDREQMEAARLDGAKGPAMFYYIILPHLLRPISVVIMIETIFLLS
IFAEILVTTSGGPGIATTTLTYFIYLKALLQWDIGGASAAGVIAIVLANIVAFFLIRTVA
RNLDN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory