Comparing WP_100845790.1 NCBI__GCF_003031005.1:WP_100845790.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
8i3yD Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
53% identity, 97% coverage: 5:219/221 of query aligns to 257:470/471 of 8i3yD
Sites not aligning to the query:
8i40A Crystal structure of asct from trypanosoma brucei in complex with coa.
53% identity, 97% coverage: 5:219/221 of query aligns to 253:466/467 of 8i40A
8i3yA Crystal structure of asct from trypanosoma brucei in complex with succinyl-coa.
55% identity, 88% coverage: 6:199/221 of query aligns to 248:441/459 of 8i3yA
Sites not aligning to the query:
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
52% identity, 96% coverage: 5:217/221 of query aligns to 302:517/520 of Q29551
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
52% identity, 96% coverage: 5:217/221 of query aligns to 250:465/468 of 1o9lA
Sites not aligning to the query:
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
52% identity, 96% coverage: 5:217/221 of query aligns to 249:464/466 of 3k6mC
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
51% identity, 98% coverage: 3:218/221 of query aligns to 243:461/462 of 3oxoE
>WP_100845790.1 NCBI__GCF_003031005.1:WP_100845790.1
MALSREQMAQRVAREMQDGYYVNLGIGIPTLVANYIPEGMEVMLQSENGLLGMGPFPTEE
TIDADMINAGKQTVTARIGASIFSSAESFAMIRGGHVDLTVLGAFEVDVEGNIASWMIPG
KLVKGMGGAMDLVAGADNIIVIMTHASKDGESKLLSKCSLPLTGAGCIKRVLTDLAYLEI
ENGAFVLKERAPGVSVEEIVAKTAGKLIVPDHVPEMQFAAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory