Comparing WP_101442815.1 NCBI__GCF_002846395.1:WP_101442815.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
38% identity, 97% coverage: 6:376/383 of query aligns to 23:394/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
38% identity, 97% coverage: 6:376/383 of query aligns to 15:386/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
38% identity, 97% coverage: 6:376/383 of query aligns to 15:386/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
38% identity, 97% coverage: 6:376/383 of query aligns to 15:386/387 of 1vefA
Sites not aligning to the query:
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
40% identity, 98% coverage: 1:376/383 of query aligns to 12:383/390 of A0QYS9
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
40% identity, 95% coverage: 19:382/383 of query aligns to 35:399/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
40% identity, 95% coverage: 19:380/383 of query aligns to 29:391/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
40% identity, 95% coverage: 19:380/383 of query aligns to 29:391/391 of 7nn4A
Sites not aligning to the query:
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
37% identity, 98% coverage: 3:376/383 of query aligns to 3:375/375 of 2eh6A
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
37% identity, 98% coverage: 3:376/383 of query aligns to 4:376/376 of O66442
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum (see paper)
36% identity, 98% coverage: 3:376/383 of query aligns to 10:389/390 of 8ht4B
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 94% coverage: 19:377/383 of query aligns to 85:454/457 of Q9M8M7
Sites not aligning to the query:
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
36% identity, 92% coverage: 21:371/383 of query aligns to 75:444/459 of P42588
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
36% identity, 92% coverage: 21:371/383 of query aligns to 69:438/453 of 4uoxA
Sites not aligning to the query:
8r2pD Yzwideal x16 a scaffold for cryo-em of small proteins of interest crystallizing in space group 19 (p 21 21 21)
36% identity, 92% coverage: 21:371/383 of query aligns to 68:437/507 of 8r2pD
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
36% identity, 98% coverage: 1:376/383 of query aligns to 9:390/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
36% identity, 98% coverage: 1:376/383 of query aligns to 1:382/385 of Q9X2A5
P73133 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa) (see paper)
34% identity, 95% coverage: 3:364/383 of query aligns to 35:413/429 of P73133
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 99% coverage: 3:380/383 of query aligns to 17:404/405 of P40732
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
34% identity, 99% coverage: 3:380/383 of query aligns to 12:399/402 of 4jevB
>WP_101442815.1 NCBI__GCF_002846395.1:WP_101442815.1
MNLFDVYPLFDIEPVRAAGLSVWDKEGRKYLDLYGGHAVISIGHSHPHYVKRIARQLYDI
GFYSNAVQMPMQQELAVKLGKLSGYDAYSFFLCNSGAEANENALKLASFQTGRKKVISFS
ASFHGRTSAAVAATDDTSIVAPINQTDNIIFMPFNDVAAFEEALQKHGQELAAVIVEGIQ
GVGGVNIPTVNFLKALEAGCKKVGALLILDEVQSGYGRSGKFFAHQHAGIQPDLITVAKG
MGNGFPVGGVLISPEIEARHGMLGTTFGGNYLACAASLAVLEVIEKEELLENATIMGHYL
KEQLEGMPGVKEVRGQGLMIGIELNEPCAGIRKELLSQFGIFTGSSSNKNTLRLLPALTI
SKAEADLFLKAFSSILTKKVTAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory