Comparing WP_104485284.1 NCBI__GCF_002936955.1:WP_104485284.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
74% identity, 100% coverage: 1:404/404 of query aligns to 1:404/404 of 4cvqA
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
74% identity, 100% coverage: 1:404/404 of query aligns to 1:404/405 of P0A959
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
39% identity, 98% coverage: 7:401/404 of query aligns to 3:392/393 of 1xi9C
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 91% coverage: 35:403/404 of query aligns to 27:386/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
29% identity, 91% coverage: 35:403/404 of query aligns to 27:386/388 of 1gd9A
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
28% identity, 90% coverage: 34:398/404 of query aligns to 75:437/464 of Q93703
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
26% identity, 96% coverage: 15:403/404 of query aligns to 17:479/479 of 3tcmA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
27% identity, 93% coverage: 24:399/404 of query aligns to 28:382/384 of 1o4sB
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
26% identity, 95% coverage: 21:403/404 of query aligns to 18:399/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
26% identity, 95% coverage: 21:403/404 of query aligns to 19:400/400 of Q02635
Sites not aligning to the query:
1j32A Aspartate aminotransferase from phormidium lapideum
26% identity, 97% coverage: 7:399/404 of query aligns to 4:384/388 of 1j32A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 93% coverage: 21:396/404 of query aligns to 29:403/410 of P58350
P04694 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 91% coverage: 35:402/404 of query aligns to 73:442/454 of P04694
Sites not aligning to the query:
Q9LR30 Glutamate--glyoxylate aminotransferase 1; AtGGT2; Alanine aminotransferase GGT1; Alanine--glyoxylate aminotransferase GGT1; Alanine-2-oxoglutarate aminotransferase 1; EC 2.6.1.4; EC 2.6.1.2; EC 2.6.1.44; EC 2.6.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 95% coverage: 15:398/404 of query aligns to 20:464/481 of Q9LR30
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
27% identity, 93% coverage: 21:396/404 of query aligns to 19:393/400 of 6f35A
P17735 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Homo sapiens (Human) (see paper)
27% identity, 91% coverage: 35:402/404 of query aligns to 73:442/454 of P17735
3dydA Human tyrosine aminotransferase
27% identity, 91% coverage: 35:402/404 of query aligns to 17:386/388 of 3dydA
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
26% identity, 94% coverage: 21:401/404 of query aligns to 21:397/402 of P14909
Sites not aligning to the query:
3ihjA Human alanine aminotransferase 2 in complex with plp
28% identity, 81% coverage: 71:398/404 of query aligns to 92:453/461 of 3ihjA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
28% identity, 97% coverage: 7:399/404 of query aligns to 5:382/382 of 1gc4A
>WP_104485284.1 NCBI__GCF_002936955.1:WP_104485284.1
MYSVEKSHKLDNVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAPFGFDAPEELLKDIIV
NLPTSQGYCDSKGLFSARKAVMQYYQQKGLRTTDLDDIYIGNGVSELIVMAMQALLNNGD
EILVPSPDYPLWTAAVTLSGGKAVHYLCDEQADWYPDLDDIKSRITPRTRGIVLINPNNP
TGAVYGSEFLLEVIEIARQNKLIIFADEIYDKILYDDVAHHSVCTLCDDVLVATFNGLSK
SYRAAGFRQGWMMLSGPKHQAKGYIEGLEMLSSMRLCANVPMQHSIQAALGGYQSINELV
LPGGRLRQQRDRAWELLNEIPGVSCVKPKGAIYMFPRLDPKMYNIKDDQKMVYDLLLQEK
MLLVQGTGFNWPTPDHFRLVTLPRVEELEDAIGRLARFLKHYRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory