Comparing WP_104913803.1 NCBI__GCF_002950575.1:WP_104913803.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
4dlfA Crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group p3221
32% identity, 98% coverage: 2:280/285 of query aligns to 2:286/287 of 4dlfA
>WP_104913803.1 NCBI__GCF_002950575.1:WP_104913803.1
MMRIDSHHHVWDLSVREQDWMVGDAVAPISRTFTMADMDPVLEQSHIDNTVIVQTVAVME
ETPEFLDIARDHPKVAAVVGWLDMESDDITPALESHLAHPESKRLVSIRDLAQYQEDPNW
LSRDSVVRNIQRLGERGLSYDLLTLPPQLPAAIDAVKRSPDVQFVLDHISKPYIADGEID
AWAKDMRALAQYPNVAVKISGMVTEAKWDDWTPETFRPYVDVCAEAFGPSRLMFGSDWPV
SLLGGQYADIVGIVETLTADWSEAEQEAIWAHTAISAYRLEGLLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory