SitesBLAST
Comparing WP_106711064.1 NCBI__GCF_003010955.1:WP_106711064.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
47% identity, 98% coverage: 6:307/307 of query aligns to 4:304/311 of 3bazA
- active site: L98 (= L100), R230 (= R233), A251 (= A254), D254 (= D257), E259 (= E262), H277 (= H280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (= V76), G149 (= G152), L150 (= L153), G151 (= G154), R152 (= R155), I153 (= I156), S172 (≠ T175), R173 (= R176), S174 (≠ N177), C201 (≠ L204), P202 (= P205), T207 (= T210), I228 (= I231), G229 (≠ A232), R230 (= R233), D254 (= D257), H277 (= H280), G279 (= G282)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
47% identity, 98% coverage: 6:307/307 of query aligns to 6:306/313 of Q65CJ7
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
44% identity, 99% coverage: 1:304/307 of query aligns to 1:301/319 of 5v6qB
- active site: L96 (= L100), R230 (= R233), D254 (= D257), E259 (= E262), H277 (= H280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (= V76), V100 (≠ T104), F148 (≠ V151), L150 (= L153), G151 (= G154), R152 (= R155), I153 (= I156), T172 (= T175), R173 (= R176), V201 (≠ L204), P202 (= P205), S206 (≠ A209), T207 (= T210), V228 (≠ I231), G229 (≠ A232), R230 (= R233), H277 (= H280), A279 (≠ G282)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
44% identity, 97% coverage: 6:304/307 of query aligns to 4:299/317 of 5v7gA
- active site: L94 (= L100), R228 (= R233), D252 (= D257), E257 (= E262), H275 (= H280)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (= V76), V98 (≠ T104), F146 (≠ V151), L148 (= L153), G149 (= G154), R150 (= R155), I151 (= I156), T170 (= T175), R171 (= R176), V199 (≠ L204), P200 (= P205), S204 (≠ A209), T205 (= T210), V226 (≠ I231), G227 (≠ A232), R228 (= R233), H275 (= H280), A277 (≠ G282)
- binding oxalate ion: G69 (= G75), V70 (= V76), G71 (= G77), R228 (= R233), H275 (= H280)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
44% identity, 97% coverage: 6:304/307 of query aligns to 5:300/319 of 5v7nA
- active site: L95 (= L100), R229 (= R233), D253 (= D257), E258 (= E262), H276 (= H280)
- binding 2-keto-D-gluconic acid: G70 (= G75), V71 (= V76), G72 (= G77), R229 (= R233), H276 (= H280), S279 (= S283), R285 (= R289)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (= V76), V99 (≠ T104), L149 (= L153), G150 (= G154), R151 (= R155), I152 (= I156), T171 (= T175), R172 (= R176), V200 (≠ L204), P201 (= P205), S205 (≠ A209), T206 (= T210), V227 (≠ I231), G228 (≠ A232), R229 (= R233), H276 (= H280), A278 (≠ G282)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
44% identity, 97% coverage: 6:304/307 of query aligns to 4:299/318 of 5j23A
- active site: L94 (= L100), R228 (= R233), D252 (= D257), E257 (= E262), H275 (= H280)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (= V76), L148 (= L153), G149 (= G154), R150 (= R155), I151 (= I156), T170 (= T175), R171 (= R176), P200 (= P205), S204 (≠ A209), T205 (= T210), R228 (= R233)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
42% identity, 82% coverage: 48:300/307 of query aligns to 48:308/334 of 5aovA
- active site: L100 (= L100), R241 (= R233), D265 (= D257), E270 (= E262), H288 (= H280)
- binding glyoxylic acid: M52 (≠ S52), L53 (≠ T53), L53 (≠ T53), Y74 (≠ F74), A75 (≠ G75), V76 (= V76), G77 (= G77), R241 (= R233), H288 (= H280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (= T104), F158 (≠ L153), G159 (= G154), R160 (= R155), I161 (= I156), S180 (≠ T175), R181 (= R176), A211 (≠ I203), V212 (≠ L204), P213 (= P205), T218 (= T210), I239 (= I231), A240 (= A232), R241 (= R233), H288 (= H280), G290 (= G282)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
41% identity, 82% coverage: 48:300/307 of query aligns to 47:307/332 of 6biiA
- active site: L99 (= L100), R240 (= R233), D264 (= D257), E269 (= E262), H287 (= H280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (= V76), T103 (= T104), G156 (= G152), F157 (≠ L153), G158 (= G154), R159 (= R155), I160 (= I156), A179 (≠ T175), R180 (= R176), S181 (≠ N177), K183 (= K179), V211 (≠ L204), P212 (= P205), E216 (≠ A209), T217 (= T210), V238 (≠ I231), A239 (= A232), R240 (= R233), D264 (= D257), H287 (= H280), G289 (= G282)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
40% identity, 92% coverage: 20:300/307 of query aligns to 19:308/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
40% identity, 92% coverage: 20:300/307 of query aligns to 19:308/333 of 2dbqA
- active site: L100 (= L100), R241 (= R233), D265 (= D257), E270 (= E262), H288 (= H280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V76), T104 (= T104), L158 (= L153), G159 (= G154), R160 (= R155), I161 (= I156), S180 (≠ T175), R181 (= R176), T182 (≠ N177), A211 (≠ I203), V212 (≠ L204), P213 (= P205), T218 (= T210), I239 (= I231), A240 (= A232), R241 (= R233), D265 (= D257), H288 (= H280), G290 (= G282)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
35% identity, 76% coverage: 68:300/307 of query aligns to 75:313/328 of Q9UBQ7
- VG 83:84 (= VG 76:77) binding substrate
- GRI 162:164 (= GRI 154:156) binding NADP(+)
- RQPR 185:188 (≠ RNKK 176:179) binding NADP(+)
- S217 (≠ P205) binding NADP(+)
- I243 (= I231) binding NADP(+)
- R245 (= R233) binding substrate
- D269 (= D257) binding substrate
- HIGS 293:296 (≠ HMGS 280:283) binding substrate
- G295 (= G282) binding NADP(+)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
35% identity, 76% coverage: 68:300/307 of query aligns to 71:309/324 of 2gcgA
- active site: L103 (= L100), R241 (= R233), D265 (= D257), E270 (= E262), H289 (= H280)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G75), V79 (= V76), G80 (= G77), R241 (= R233), H289 (= H280)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (= V76), T107 (= T104), G156 (= G152), G158 (= G154), I160 (= I156), G180 (≠ T175), R181 (= R176), R184 (≠ K179), C212 (≠ L204), S213 (≠ P205), T218 (= T210), I239 (= I231), R241 (= R233), D265 (= D257), H289 (= H280), G291 (= G282)
Sites not aligning to the query:
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
33% identity, 96% coverage: 6:301/307 of query aligns to 3:303/304 of 1wwkA
- active site: S96 (≠ L100), R230 (= R233), D254 (= D257), E259 (= E262), H278 (= H280)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ T104), G146 (= G152), F147 (≠ L153), G148 (= G154), R149 (= R155), I150 (= I156), Y168 (vs. gap), D169 (vs. gap), P170 (≠ T172), V201 (≠ L204), P202 (= P205), T207 (= T210), T228 (≠ I231), S229 (≠ A232), D254 (= D257), H278 (= H280), G280 (= G282)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
37% identity, 77% coverage: 55:290/307 of query aligns to 51:287/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
37% identity, 77% coverage: 55:290/307 of query aligns to 52:288/525 of 3ddnB
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
28% identity, 80% coverage: 50:296/307 of query aligns to 52:299/533 of O43175
- T78 (≠ V76) binding NAD(+)
- R135 (= R133) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (= RI 155:156) binding NAD(+)
- D175 (≠ T175) binding NAD(+)
- T207 (≠ L204) binding NAD(+)
- CAR 234:236 (≠ IAR 231:233) binding NAD(+)
- D260 (= D257) binding NAD(+)
- V261 (= V258) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HMGS 280:283) binding NAD(+)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
7dkmA Phgdh covalently linked to oridonin (see paper)
28% identity, 80% coverage: 50:296/307 of query aligns to 48:295/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V76), A102 (≠ T104), G148 (= G152), R151 (= R155), I152 (= I156), Y170 (≠ H174), D171 (≠ T175), P172 (≠ R176), I173 (≠ N177), H202 (≠ I203), T203 (≠ L204), P204 (= P205), T209 (= T210), C230 (≠ I231), A231 (= A232), R232 (= R233), H279 (= H280), G281 (= G282)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ D294)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
28% identity, 80% coverage: 50:296/307 of query aligns to 48:295/305 of 6plfA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
28% identity, 80% coverage: 50:296/307 of query aligns to 47:294/301 of 6rj5A
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
28% identity, 80% coverage: 50:296/307 of query aligns to 46:293/297 of 6rj3A
Query Sequence
>WP_106711064.1 NCBI__GCF_003010955.1:WP_106711064.1
MAKHPVLVLGPLMPYLLEELERRYAVERLYEEKDALGFLQQNAARFRAAVTSTFTGLKAD
MIDLLPAVEIVSSFGVGTDSLDVAYANKKGIKVANTPDVLNEDTANMAIALLLATTRDIV
ANDRFVREGRWARGETPPLAQGIEGKKVGLVGLGRIGSVIAEKLLAFGCDVTYHTRNKKP
DVSYNHCADLVAMARDCAVLIAILPGGDATQGIISREVLQALGSKGTFINIARGSVVDEV
ALVELLQSGGLGRAGLDVFADEPRAPEALFALDNVVLQPHMGSATVETREAMADRVVSNL
ENYFGAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory