SitesBLAST
Comparing WP_106714457.1 NCBI__GCF_003010955.1:WP_106714457.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dm3C Crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp
52% identity, 98% coverage: 7:454/456 of query aligns to 2:396/396 of 5dm3C
- active site: E115 (= E143), E117 (= E145), E162 (= E206), E169 (= E213), H218 (= H262), R286 (= R335), E303 (= E352), R305 (= R354)
- binding adenosine-5'-diphosphate: R173 (= R217), C174 (≠ Y218), H220 (= H264), S222 (= S266), R301 (= R350)
5dm3A Crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp
50% identity, 98% coverage: 7:454/456 of query aligns to 4:374/374 of 5dm3A
- active site: E107 (= E143), E109 (= E145), E146 (= E206), E150 (= E213), H199 (= H262), R265 (= R335), E282 (= E352), R284 (= R354)
- binding adenosine-5'-diphosphate: I103 (≠ Y139), E141 (= E201), R154 (= R217), C155 (≠ Y218), H201 (= H264), S203 (= S266), R280 (= R350)
8oooA Glutamine synthetase from methanothermococcus thermolithotrophicus in complex with 2-oxoglutarate and mgatp at 2.15 a resolution (see paper)
32% identity, 81% coverage: 80:448/456 of query aligns to 70:440/447 of 8oooA
- binding 2-oxoglutaric acid: R87 (≠ L97), V93 (≠ C100), P170 (≠ D183), R173 (≠ M186), R174 (= R187), S190 (= S203)
- binding adenosine-5'-triphosphate: E136 (= E143), E188 (= E201), F203 (≠ V216), K204 (≠ R217), F205 (≠ Y218), H251 (= H264), S253 (= S266), R325 (= R340), R335 (= R350)
Sites not aligning to the query:
8ooqB Glutamine synthetase from Methanothermococcus thermolithotrophicus (see paper)
32% identity, 81% coverage: 81:448/456 of query aligns to 70:439/446 of 8ooqB
Sites not aligning to the query:
8oozA Glutamine synthetase (see paper)
32% identity, 82% coverage: 81:456/456 of query aligns to 58:430/430 of 8oozA
- binding adenosine-5'-triphosphate: G117 (≠ A141), E170 (= E201), F185 (≠ V216), K186 (≠ R217), Y187 (= Y218), N233 (≠ H264), S235 (= S266), S315 (≠ G348), R317 (= R350)
- binding magnesium ion: E119 (= E143), H231 (= H262), E319 (= E352)
8ooxB Glutamine synthetase (see paper)
32% identity, 82% coverage: 81:456/456 of query aligns to 64:438/438 of 8ooxB
A0R083 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 81% coverage: 81:449/456 of query aligns to 66:440/446 of A0R083
- K363 (≠ E379) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8tfkA Glutamine synthetase (see paper)
32% identity, 81% coverage: 81:451/456 of query aligns to 64:435/440 of 8tfkA
- binding adenosine-5'-diphosphate: E128 (= E143), D194 (≠ N215), F195 (≠ V216), F197 (≠ Y218), N243 (≠ H264), R312 (= R335), R317 (= R340), G325 (= G348), R327 (= R350)
- binding magnesium ion: E128 (= E143), E128 (= E143), E130 (= E145), E185 (= E206), E192 (= E213), E192 (= E213), H241 (= H262), E329 (= E352)
- binding l-methionine-s-sulfoximine phosphate: E128 (= E143), E130 (= E145), E185 (= E206), E192 (= E213), G237 (= G258), H241 (= H262), R294 (= R317), E300 (≠ F323), R312 (= R335), R331 (= R354)
8s59O Glutamine synthetase
32% identity, 81% coverage: 81:451/456 of query aligns to 70:441/446 of 8s59O
Sites not aligning to the query:
8tfbA Glutamine synthetase (see paper)
32% identity, 81% coverage: 81:451/456 of query aligns to 67:438/443 of 8tfbA
7tdpA Structure of paenibacillus polymyxa gs bound to met-sox-p-adp (transition state complex) to 1.98 angstom (see paper)
33% identity, 81% coverage: 80:448/456 of query aligns to 64:431/439 of 7tdpA
- binding adenosine-5'-diphosphate: N123 (vs. gap), G125 (≠ A141), E127 (= E143), E179 (= E201), D193 (≠ N215), Y196 (= Y218), N242 (≠ H264), S244 (= S266), R316 (= R340), R326 (= R350)
- binding magnesium ion: E127 (= E143), E127 (= E143), E129 (= E145), E184 (= E206), E191 (= E213), E191 (= E213), H240 (= H262), E328 (= E352)
- binding l-methionine-s-sulfoximine phosphate: E127 (= E143), E129 (= E145), E184 (= E206), E191 (= E213), G236 (= G258), H240 (= H262), R293 (= R317), E299 (≠ F323), R311 (= R335), R330 (= R354)
P9WN37 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 81% coverage: 81:449/456 of query aligns to 66:440/446 of P9WN37
- K363 (≠ E379) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8wwuB Glutamine synthetase (see paper)
30% identity, 82% coverage: 78:453/456 of query aligns to 95:489/492 of 8wwuB
- binding phosphoaminophosphonic acid-adenylate ester: G157 (≠ A141), E159 (= E143), R226 (≠ E201), F241 (≠ V216), V243 (≠ Y218), H290 (= H264), S292 (= S266), K360 (≠ R335), R365 (= R340), R376 (= R350)
- binding magnesium ion: E159 (= E143), E238 (= E213)
- binding manganese (ii) ion: E159 (= E143), E161 (= E145), E231 (= E206), E238 (= E213), H288 (= H262), E378 (= E352)
8wwvA Glutamine synthetase (see paper)
30% identity, 82% coverage: 78:453/456 of query aligns to 93:487/490 of 8wwvA
- binding adenosine-5'-diphosphate: G155 (≠ A141), E157 (= E143), R224 (≠ E201), F239 (≠ V216), D240 (≠ R217), V241 (≠ Y218), H288 (= H264), S290 (= S266), R374 (= R350), E376 (= E352)
- binding magnesium ion: E157 (= E143), E236 (= E213)
- binding manganese (ii) ion: E157 (= E143), E159 (= E145), E229 (= E206), E236 (= E213), H286 (= H262), E376 (= E352)
- binding l-methionine-s-sulfoximine phosphate: E157 (= E143), E159 (= E145), E229 (= E206), E236 (= E213), A282 (≠ G258), H286 (= H262), R340 (= R317), K358 (≠ R335)
7tfaB Glutamine synthetase (see paper)
32% identity, 81% coverage: 80:448/456 of query aligns to 64:433/441 of 7tfaB
- binding glutamine: E131 (= E145), Y153 (= Y170), E186 (= E206), G238 (= G258), H242 (= H262), R295 (= R317), E301 (≠ F323)
- binding magnesium ion: E129 (= E143), E131 (= E145), E186 (= E206), E193 (= E213), H242 (= H262), E330 (= E352)
- binding : V187 (≠ W207), N237 (≠ A257), G299 (= G321), Y300 (≠ T322), R313 (= R335), M424 (≠ E439)
Sites not aligning to the query:
7tenA Glutamine synthetase (see paper)
31% identity, 83% coverage: 80:456/456 of query aligns to 64:442/442 of 7tenA
- binding adenosine-5'-diphosphate: G128 (≠ A141), E130 (= E143), E182 (= E201), D196 (≠ N215), F197 (≠ V216), K198 (≠ R217), Y199 (= Y218), N245 (≠ H264), S247 (= S266), R319 (= R340), S327 (≠ G348), R329 (= R350)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E143), E132 (= E145), E187 (= E206), E194 (= E213), N238 (≠ A257), G239 (= G258), H243 (= H262), R296 (= R317), E302 (≠ F323), R314 (= R335), R333 (= R354)
7tf9S L. Monocytogenes gs(14)-q-glnr peptide (see paper)
31% identity, 83% coverage: 80:456/456 of query aligns to 65:443/443 of 7tf9S
- binding glutamine: E133 (= E145), Y155 (= Y170), E188 (= E206), G240 (= G258), G242 (≠ S260), R297 (= R317), E303 (≠ F323)
- binding magnesium ion: E131 (= E143), E133 (= E145), E188 (= E206), E195 (= E213), H244 (= H262), E332 (= E352)
- binding : E418 (≠ H431), I422 (≠ W435), M426 (≠ E439)
Sites not aligning to the query:
P12425 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 from Bacillus subtilis (strain 168) (see 5 papers)
31% identity, 83% coverage: 80:456/456 of query aligns to 66:444/444 of P12425
- E132 (= E143) binding Mg(2+)
- E134 (= E145) binding Mg(2+)
- E189 (= E206) binding Mg(2+)
- V190 (≠ W207) mutation to A: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant partially relieves expression of the glnRA-lacZ fusion, but has no effect on the TnrA-dependent regulation of amtB-lacZ fusion. Resistant to inhibition by MetSox.
- E196 (= E213) binding Mg(2+)
- G241 (= G258) binding L-glutamate
- H245 (= H262) binding Mg(2+)
- G302 (= G321) mutation to E: Unable to form stable complex with TnrA. In the presence of glutamine, amtB-lacZ fusion is only 4-fold regulated by TnrA, whereas glnRA-lacZ fusion is derepressed. This mutant retains enzymatic specific activity with a 2-fold decrease of the affinity for glutamate and glutamine compared to the wild-type. Slightly less sensitive to inhibition by glutamine.
- E304 (≠ F323) mutation to A: Highly resistant to Met-Sox inhibition. 8- and 2-fold increase of the affinity for glutamate and ATP, respectively. Strong decrease of the affinity for ammonium.
- P306 (= P325) mutation to H: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant completely derepresses glnRA-lacZ fusion, whereas amtB-lacZ fusion expression is only partially derepresses.
- E333 (= E352) binding Mg(2+)
- E424 (= E436) mutation to K: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant derepresses amtB-lacZ fusion and glnRA-lacZ fusion. Although it is defective in regulation, this mutant retains enzymatic specific activity and similar affinity for ATP, glutamate and glutamine compared to the wild-type. Slightly less sensitive to inhibition by glutamine.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 59 G→R: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant derepresses amtB-lacZ fusion and glnRA-lacZ fusion.
- 62 Important for inhibition by glutamine; R→A: Highly resistant to inhibition by glutamine and AMP. Regulation by TnrA and GlnR is abolished. Only small differences (less than 2-fold) in its steady-state kinetic constants compared with the wild-type. Similar sensitivity to Met-Sox that compared to the wild-ytpe.
4lnkA B. Subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of gs-glutamate-amppcp complex (see paper)
31% identity, 83% coverage: 80:456/456 of query aligns to 65:443/443 of 4lnkA
- active site: E131 (= E143), E133 (= E145), E188 (= E206), E195 (= E213), H244 (= H262), R315 (= R335), E332 (= E352), R334 (= R354)
- binding adenosine-5'-diphosphate: F198 (≠ V216), Y200 (= Y218), N246 (≠ H264), S248 (= S266), S324 (≠ E344), S328 (≠ G348), R330 (= R350)
- binding glutamic acid: E133 (= E145), E188 (= E206), V189 (≠ W207), N239 (≠ A257), G240 (= G258), G242 (≠ S260), E303 (≠ F323)
- binding magnesium ion: E131 (= E143), E188 (= E206), E195 (= E213), H244 (= H262), E332 (= E352)
Sites not aligning to the query:
4lniA B. Subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex (see paper)
31% identity, 83% coverage: 80:456/456 of query aligns to 65:443/443 of 4lniA
- active site: E131 (= E143), E133 (= E145), E188 (= E206), E195 (= E213), H244 (= H262), R315 (= R335), E332 (= E352), R334 (= R354)
- binding adenosine-5'-diphosphate: E131 (= E143), E183 (= E201), D197 (≠ N215), Y200 (= Y218), N246 (≠ H264), S248 (= S266), R320 (= R340), R330 (= R350)
- binding magnesium ion: E131 (= E143), E131 (= E143), E133 (= E145), E188 (= E206), E195 (= E213), E195 (= E213), H244 (= H262), E332 (= E352)
- binding l-methionine-s-sulfoximine phosphate: E133 (= E145), E188 (= E206), H244 (= H262), R297 (= R317), E303 (≠ F323), R315 (= R335), R334 (= R354)
Sites not aligning to the query:
Query Sequence
>WP_106714457.1 NCBI__GCF_003010955.1:WP_106714457.1
MPGHWNFDELKRRVNNGEIDTVLACFVDMQGRLIGKRFHATYFVESAHDETHGCNYLLAN
DIDMEPVPGYKAASWKQGYGDFIIKPDLSTIRHIPWLEKCALVLCDILDHHHHEDLAHSP
RSILKRQLARLKERGYLAYFASELEFYLFDETYETARAKHWKGMNTASPYIQDYVIQMTT
KEDAVMRAIRNGLFDAGIPVENSKGEWGPGQEEINVRYAEALEMADRHVVMKNGCKEIAT
QMGKAITFMAKYDYSLAGSSSHVHNSLWSADGKTPLFYDKKAEHTMSPLMRQWVAGQLKY
ADDFTYFLAPYINSYKRFQAGTFAPTKSVWSLDNRTAGFRLCGEGTKGIRIECRIGGADL
NPYLAFAGLIASGLAGIDEKLDLGPPFQGDAYGGTRLKEIPKTLREATETLARSKMLKEA
LGEDVVEHYVHTAKWEQFEYDRRVTDWELHRGFERY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory