Comparing WP_106715487.1 NCBI__GCF_003010935.1:WP_106715487.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rbxC Crystal structure of isocitrate lyase and phosphorylmutase:isocitrate lyase from brucella melitensis biovar abortus 2308 bound to itaconic acid (see paper)
89% identity, 99% coverage: 2:426/429 of query aligns to 1:425/425 of 7rbxC
6lrtA Crystal structure of isocitrate lyase (caur_3889) from chloroflexus aurantiacus in complex with isocitrate and manganese ion
73% identity, 97% coverage: 10:424/429 of query aligns to 15:423/423 of 6lrtA
7cmyC Isocitrate lyase from bacillus cereus atcc 14579 in complex with magnessium ion, glyoxylate, and succinate
68% identity, 96% coverage: 15:424/429 of query aligns to 17:417/417 of 7cmyC
6xppA Crystal structure of itaconate modified mycobaterium tuberculosis isocitrate lyase (see paper)
67% identity, 96% coverage: 15:424/429 of query aligns to 21:426/426 of 6xppA
7rb1A Isocitrate lyase-1 from mycobacterium tuberculosis covalently modified by 5-descarboxy-5-nitro-d-isocitric acid (see paper)
67% identity, 96% coverage: 15:424/429 of query aligns to 22:427/427 of 7rb1A
6wsiA Intact cis-2,3-epoxysuccinic acid bound to isocitrate lyase-1 from mycobacterium tuberculosis (see paper)
67% identity, 96% coverage: 15:424/429 of query aligns to 22:427/427 of 6wsiA
6vb9A Covalent adduct of cis-2,3-epoxysuccinic acid with isocitrate lyase-1 from mycobacterium tuberculosis (see paper)
67% identity, 96% coverage: 15:424/429 of query aligns to 22:427/427 of 6vb9A
5dqlA Crystal structure of 2-vinyl glyoxylate modified isocitrate lyase from mycobacterium tuberculosis (see paper)
67% identity, 96% coverage: 15:424/429 of query aligns to 22:427/427 of 5dqlA
P9WKK7 Isocitrate lyase; ICL; Isocitrase; Isocitratase; EC 4.1.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
67% identity, 96% coverage: 15:425/429 of query aligns to 22:428/428 of P9WKK7
6c4aA Crystal structure of 3-nitropropionate modified isocitrate lyase from mycobacterium tuberculosis with pyruvate (see paper)
67% identity, 96% coverage: 15:424/429 of query aligns to 23:428/428 of 6c4aA
1f8iA Crystal structure of isocitrate lyase:nitropropionate:glyoxylate complex from mycobacterium tuberculosis (see paper)
67% identity, 96% coverage: 15:424/429 of query aligns to 22:427/427 of 1f8iA
P0A9G6 Isocitrate lyase; ICL; Isocitrase; Isocitratase; EC 4.1.3.1 from Escherichia coli (strain K12) (see 3 papers)
60% identity, 96% coverage: 15:424/429 of query aligns to 19:434/434 of P0A9G6
Sites not aligning to the query:
1igwC Crystal structure of the isocitrate lyase from the a219c mutant of escherichia coli (see paper)
60% identity, 92% coverage: 15:407/429 of query aligns to 18:416/416 of 1igwC
1igwA Crystal structure of the isocitrate lyase from the a219c mutant of escherichia coli (see paper)
56% identity, 92% coverage: 15:407/429 of query aligns to 18:396/396 of 1igwA
5e9fD Structural insights of isocitrate lyases from magnaporthe oryzae (see paper)
36% identity, 92% coverage: 12:406/429 of query aligns to 29:453/453 of 5e9fD
5e9gD Structural insights of isocitrate lyases from magnaporthe oryzae (see paper)
35% identity, 92% coverage: 12:407/429 of query aligns to 30:486/486 of 5e9gD
8z1rB Isocitrate lyase momcl1
39% identity, 53% coverage: 15:243/429 of query aligns to 22:260/516 of 8z1rB
6edwB Crystal structure of mycobacterium tuberculosis icl2 in the apo form (see paper)
38% identity, 53% coverage: 15:243/429 of query aligns to 22:262/746 of 6edwB
Sites not aligning to the query:
6edzA Crystal structure of mycobacterium tuberculosis icl2 in complex with acetyl-coa, form i (see paper)
38% identity, 53% coverage: 15:243/429 of query aligns to 22:262/733 of 6edzA
Sites not aligning to the query:
6edwC Crystal structure of mycobacterium tuberculosis icl2 in the apo form (see paper)
38% identity, 53% coverage: 15:243/429 of query aligns to 22:262/724 of 6edwC
Sites not aligning to the query:
>WP_106715487.1 NCBI__GCF_003010935.1:WP_106715487.1
MTDFYNLVPNAPEGRYDGIARPYSPDDVQRLRGSVQIKYTLAENGANRLWKLIHEDGFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELAKRINKT
LQRADQIETAEGKGLSVDTWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTTEGFYQVKNGLEPCIARAVAYAPYCDMIWCETSKPDLEQARRFAEGVRKE
HPNKLLAYNCSPSFNWKKHLDEATIARFQRELGAMGYKFQFITLAGFHQLNFGMFELARG
YKDRQMSAYSELQEAEFAAEVNGYTATKHQREVGTGYFDAVSLAITGGTSSTTAMKESTE
TAQFRPAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory