SitesBLAST
Comparing WP_106716783.1 NCBI__GCF_003010935.1:WP_106716783.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fpyA Crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin (see paper)
64% identity, 100% coverage: 3:469/469 of query aligns to 1:468/468 of 1fpyA
- binding adenosine-5'-diphosphate: G127 (= G129), E129 (= E131), E207 (= E209), T223 (≠ I224), F225 (= F226), H271 (= H272), S273 (= S274), R355 (= R356), E357 (= E358)
- binding manganese (ii) ion: E129 (= E131), E131 (= E133), E212 (= E214), E220 (= E221), H269 (= H270), E357 (= E358)
- binding phosphinothricin: E131 (= E133), E212 (= E214), G265 (= G266), H269 (= H270), R321 (= R322), E327 (= E328), R359 (= R360)
1f1hA Crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions (see paper)
64% identity, 100% coverage: 3:469/469 of query aligns to 1:468/468 of 1f1hA
- binding adenosine-5'-diphosphate: E129 (= E131), E207 (= E209), H210 (= H212), E220 (= E221), T223 (≠ I224), F225 (= F226), H271 (= H272), S273 (= S274), R355 (= R356)
- binding manganese (ii) ion: E129 (= E131), E131 (= E133), E212 (= E214), E220 (= E221), H269 (= H270), E357 (= E358)
P0A1P6 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
64% identity, 100% coverage: 3:469/469 of query aligns to 2:469/469 of P0A1P6
- E130 (= E131) binding Mn(2+)
- E132 (= E133) binding Mn(2+)
- E208 (= E209) binding ATP
- E213 (= E214) binding Mn(2+)
- E221 (= E221) binding Mn(2+)
- NG 265:266 (= NG 265:266) binding L-glutamate
- H270 (= H270) binding Mn(2+)
- HMS 272:274 (= HMS 272:274) binding ATP
- R322 (= R322) binding L-glutamate
- E358 (= E358) binding Mn(2+)
- R360 (= R360) binding L-glutamate
P0A9C5 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Escherichia coli (strain K12) (see 3 papers)
64% identity, 100% coverage: 3:469/469 of query aligns to 2:469/469 of P0A9C5
- Y398 (= Y398) modified: O-AMP-tyrosine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2lgsA Feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine (see paper)
60% identity, 100% coverage: 3:469/469 of query aligns to 1:445/445 of 2lgsA
- binding glutamic acid: E125 (= E133), N258 (= N265), G259 (= G266), G261 (= G268), H263 (= H270), R315 (= R322), R349 (= R360)
- binding manganese (ii) ion: E123 (= E131), E125 (= E133), E206 (= E214), E214 (= E221), H263 (= H270), E347 (= E358)
1lgrA Interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium (see paper)
60% identity, 100% coverage: 3:469/469 of query aligns to 1:445/445 of 1lgrA
- binding adenosine monophosphate: E201 (= E209), T217 (≠ I224), F219 (= F226), H265 (= H272), S267 (= S274), R345 (= R356)
- binding manganese (ii) ion: E123 (= E131), E125 (= E133), E206 (= E214), E214 (= E221), H263 (= H270), E347 (= E358)
P77961 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
56% identity, 99% coverage: 3:467/469 of query aligns to 4:471/473 of P77961
- E134 (= E133) binding Mg(2+)
- E215 (= E214) binding Mg(2+)
- E223 (= E221) binding Mg(2+)
- E361 (= E358) binding Mn(2+)
3ng0A Crystal structure of glutamine synthetase from synechocystis sp. Pcc 6803
55% identity, 99% coverage: 3:467/469 of query aligns to 2:463/465 of 3ng0A
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E213 (= E214), E221 (= E221), H270 (= H270), R340 (= R340), E359 (= E358), R361 (= R360)
- binding phosphoaminophosphonic acid-adenylate ester: Y126 (≠ F127), E130 (= E131), K209 (= K210), I224 (= I224), F226 (= F226), H272 (= H272), S274 (= S274), R340 (= R340), R345 (= R345), R357 (= R356)
- binding manganese (ii) ion: E130 (= E131), E132 (= E133), E213 (= E214), E221 (= E221), H270 (= H270), E359 (= E358), R361 (= R360)
A0R079 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
49% identity, 100% coverage: 3:469/469 of query aligns to 5:478/478 of A0R079
- K14 (= K12) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
5zlpJ Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 99% coverage: 5:469/469 of query aligns to 10:478/478 of 5zlpJ
- binding adenosine-5'-diphosphate: Y132 (≠ F127), E136 (= E131), F215 (≠ E209), F232 (= F226), H278 (= H272), S280 (= S274), R351 (= R345), R362 (= R356)
- binding magnesium ion: E138 (= E133), E220 (= E214), E227 (= E221)
- binding phosphinothricin: E138 (= E133), E220 (= E214), G272 (= G266), H276 (= H270), E334 (= E328), R346 (= R340), R366 (= R360)
5zlpL Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 99% coverage: 5:469/469 of query aligns to 8:476/476 of 5zlpL
- binding adenosine-5'-diphosphate: G132 (= G129), E134 (= E131), F213 (≠ E209), F230 (= F226), H276 (= H272), S278 (= S274), R349 (= R345), R360 (= R356)
- binding magnesium ion: E136 (= E133), E218 (= E214), E225 (= E221)
- binding (2s)-2-amino-4-[methyl(phosphonooxy)phosphoryl]butanoic acid: E136 (= E133), E218 (= E214), G270 (= G266), H274 (= H270), E332 (= E328), R344 (= R340), R364 (= R360)
5zlpA Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
47% identity, 99% coverage: 5:469/469 of query aligns to 8:476/476 of 5zlpA
2whiA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate. (see paper)
48% identity, 100% coverage: 3:469/469 of query aligns to 3:476/476 of 2whiA
- active site: D52 (= D52), E131 (= E131), E133 (= E133), E217 (= E214), E225 (= E221), H274 (= H270), R345 (= R340), E364 (= E358), R366 (= R360)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y127 (≠ F127), G129 (= G129), F230 (= F226), H276 (= H272), S278 (= S274), W280 (= W276), K359 (= K353), R362 (= R356)
- binding magnesium ion: E131 (= E131), E131 (= E131), E133 (= E133), E217 (= E214), E225 (= E221), E225 (= E221), H274 (= H270), E364 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E131), E133 (= E133), E217 (= E214), E225 (= E221), G270 (= G266), H274 (= H270), R327 (= R322), E333 (= E328), R345 (= R340), R366 (= R360)
- binding phosphate ion: E131 (= E131), R350 (= R345), E364 (= E358)
1htoA Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis (see paper)
48% identity, 100% coverage: 3:469/469 of query aligns to 4:477/477 of 1htoA
- active site: D53 (= D52), E132 (= E131), E134 (= E133), E218 (= E214), E226 (= E221), H275 (= H270), R346 (= R340), E365 (= E358), R367 (= R360)
- binding adenosine monophosphate: Y128 (≠ F127), G130 (= G129), E132 (= E131), F231 (= F226), H277 (= H272), S279 (= S274), R363 (= R356)
- binding manganese (ii) ion: E132 (= E131), H275 (= H270), E365 (= E358)
P9WN39 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 5 papers)
48% identity, 100% coverage: 3:469/469 of query aligns to 5:478/478 of P9WN39
- E133 (= E131) binding Mg(2+)
- E135 (= E133) binding Mg(2+)
- E219 (= E214) binding Mg(2+)
- E227 (= E221) binding Mg(2+)
- H276 (= H270) binding Mg(2+)
- E366 (= E358) binding Mg(2+)
- Y406 (= Y398) modified: O-AMP-tyrosine; mutation to F: Unable to be adenylylated.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4acfA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
48% identity, 100% coverage: 3:469/469 of query aligns to 2:475/475 of 4acfA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding {4-[6-bromo-3-(butylamino)imidazo[1,2-a]pyridin-2-yl]phenoxy}acetic acid: Y126 (≠ F127), F229 (= F226), H275 (= H272), Q276 (≠ M273), W279 (= W276), N356 (≠ S351), K358 (= K353), R361 (= R356)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), G269 (= G266), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
3zxvA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate (see paper)
48% identity, 100% coverage: 3:469/469 of query aligns to 2:475/475 of 3zxvA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding 4-(2-tert-butyl-4-(6-methoxynaphthalen-2-yl)-3h-imidazol-4-yl)pyridin-2-amine: Y126 (≠ F127), G128 (= G129), F229 (= F226), H275 (= H272), S277 (= S274), K358 (= K353), R361 (= R356)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), G269 (= G266), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
3zxrA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate. (see paper)
48% identity, 100% coverage: 3:469/469 of query aligns to 2:475/475 of 3zxrA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding 3-(2-tert-butyl-5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline: G128 (= G129), F229 (= F226), H275 (= H272), S277 (= S274), R361 (= R356)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
2bvcA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic (see paper)
48% identity, 100% coverage: 3:469/469 of query aligns to 2:475/475 of 2bvcA
- active site: D51 (= D52), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), H273 (= H270), R344 (= R340), E363 (= E358), R365 (= R360)
- binding adenosine-5'-diphosphate: E130 (= E131), E211 (= E209), K212 (= K210), N226 (≠ G223), F229 (= F226), H275 (= H272), S277 (= S274), R344 (= R340), R349 (= R345), R361 (= R356), E363 (= E358)
- binding magnesium ion: E130 (= E131), E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), E224 (= E221), H273 (= H270), E363 (= E358)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E131), E132 (= E133), E216 (= E214), E224 (= E221), G269 (= G266), H273 (= H270), R326 (= R322), E332 (= E328), R344 (= R340), R365 (= R360)
4xycA Nanomolar inhibitors of mycobacterium tuberculosis glutamine synthetase 1: synthesis, biological evaluation and x-ray crystallographic studies (see paper)
47% identity, 100% coverage: 3:469/469 of query aligns to 2:466/466 of 4xycA
- active site: D51 (= D52), E121 (= E131), E123 (= E133), E207 (= E214), E215 (= E221), H264 (= H270), R335 (= R340), E354 (= E358), R356 (= R360)
- binding 9-phenyl-4H-imidazo[1,2-a]indeno[1,2-e]pyrazin-4-one: Y117 (≠ F127), F220 (= F226), H266 (= H272), S268 (= S274), W270 (= W276), K349 (= K353), A350 (≠ S354), R352 (= R356)
Query Sequence
>WP_106716783.1 NCBI__GCF_003010935.1:WP_106716783.1
MTTAKDILKQIKDNDVKFLDLRFTDPKGKLQHVTMDIAEVDEDMFADGVMFDGSSIAGWK
AINESDMVLMPDTDTVHMDPFFAQSTMVILCDILDPISGESYNRDPRGTAKKAEAYMRAE
GIGDTIFVGPEAEFFVFDDVKYKADPYNTGFKLDSTELPSNDDTDYETGNLGHRPRVKGG
YFPVPPIDSAQDMRSEMLTVLTEMGVRVEKHHHEVAAAQHELGIKFDALTRNADKMLIYK
YVVHQVANAYGKTATFMPKPIFGDNGSGMHVHMSIWKEGKPTFAGNEYAGLSESCLFFIG
GIIKHAKAINAFTNPSTNSYKRLVPGYEAPVLLAYSARNRSASCRIPFGSSPKSKRVEIR
FPDPTANPYLGFAAMLMAGLDGIKNKIHPGQPMDKDLYDLPAKELKKIPTVCGSLREALQ
SLDKDRGFLKAGGVFDDDQIDSFIELKMAEVMRYEMTPHPVEYDMYYSV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory