Comparing WP_106718059.1 NCBI__GCF_003010935.1:WP_106718059.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
33% identity, 86% coverage: 7:295/337 of query aligns to 7:287/560 of 3bofA
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
33% identity, 86% coverage: 7:295/337 of query aligns to 7:287/559 of 1q8jA
Sites not aligning to the query:
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
32% identity, 86% coverage: 16:305/337 of query aligns to 13:306/841 of 8g3hA
Sites not aligning to the query:
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
28% identity, 85% coverage: 11:297/337 of query aligns to 25:340/1265 of Q99707
Sites not aligning to the query:
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 75% coverage: 44:296/337 of query aligns to 59:326/1227 of P13009
Sites not aligning to the query:
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
25% identity, 85% coverage: 11:297/337 of query aligns to 9:300/611 of 4cczA
Sites not aligning to the query:
1lt8A Reduced homo sapiens betaine-homocysteine s-methyltransferase in complex with s-(delta-carboxybutyl)-l-homocysteine (see paper)
28% identity, 74% coverage: 45:295/337 of query aligns to 42:291/348 of 1lt8A
Sites not aligning to the query:
Q93088 Betaine--homocysteine S-methyltransferase 1; EC 2.1.1.5 from Homo sapiens (Human) (see 4 papers)
26% identity, 74% coverage: 45:295/337 of query aligns to 52:314/406 of Q93088
5dmmA Crystal structure of the homocysteine methyltransferase mmum from escherichia coli, metallated form (see paper)
28% identity, 85% coverage: 5:292/337 of query aligns to 1:285/288 of 5dmmA
O09171 Betaine--homocysteine S-methyltransferase 1; EC 2.1.1.5 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 74% coverage: 45:295/337 of query aligns to 52:314/407 of O09171
Sites not aligning to the query:
4m3pA Betaine-homocysteine s-methyltransferase from homo sapiens complexed with homocysteine (see paper)
26% identity, 74% coverage: 45:295/337 of query aligns to 43:283/370 of 4m3pA
Sites not aligning to the query:
1umyD Bhmt from rat liver (see paper)
26% identity, 74% coverage: 45:295/337 of query aligns to 43:291/381 of 1umyD
>WP_106718059.1 NCBI__GCF_003010935.1:WP_106718059.1
MTIANPLADLIAEKGVLLADGATGTNLFAAGLEAGEAPELWNEAQPQKIVALHQGFVDAG
ADIILTNSFGGTRHRLKLHHAHDRVFELNKKAAELARSVADKAGRKVIVAGSVGPTGELL
IPLGALTEEDAVAAFTEQLEGLKAGGVDVAWIETMSAPGEIRAAAEAAVKVGLPYVYTGS
FDTAGKTMMGLPPKEIHGVVDGLSQPPVAVGANCGVGASDILATLLDMSDADPSATIVIK
GNCGIPEFRGAEIFYSGTPELMADYAHLAINGGAKIIGGCCGTSFEHLAAMRKALDSHTH
GARPSVETIIETIGPMRNKLAAHADDMPKRERRGRRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory