Comparing WP_108402015.1 NCBI__GCF_003063475.1:WP_108402015.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5uhsA Structure of a semisweet d57a mutant (see paper)
45% identity, 82% coverage: 7:81/91 of query aligns to 5:79/81 of 5uhsA
B0SR19 Sugar transporter SemiSWEET from Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (see paper)
44% identity, 82% coverage: 7:81/91 of query aligns to 5:79/85 of B0SR19
P0DMV3 Sugar transporter SemiSWEET from Escherichia coli (strain UMEA 3162-1) (see paper)
43% identity, 76% coverage: 21:89/91 of query aligns to 21:89/89 of P0DMV3
Sites not aligning to the query:
>WP_108402015.1 NCBI__GCF_003063475.1:WP_108402015.1
MNYTEWIGYAAASLTTASFVPQAWLTFKTRDVSGISLGMYSAFTLGIALWLAYGLLIEAW
PVVIANIITLVLAASILAMRLRFARKASAPN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory