Comparing WP_109967688.1 NCBI__GCF_003173355.1:WP_109967688.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P58315 Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; FBPA; EC 4.1.2.13 from Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1) (see paper)
31% identity, 92% coverage: 20:299/303 of query aligns to 5:263/263 of P58315
2yceE Structure of an archaeal fructose-1,6-bisphosphate aldolase with the catalytic lys covalently bound to the carbinolamine intermediate of the substrate. (see paper)
32% identity, 87% coverage: 20:283/303 of query aligns to 3:245/255 of 2yceE
1w8sA The mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates (see paper)
32% identity, 87% coverage: 20:283/303 of query aligns to 3:245/250 of 1w8sA
P58314 Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; EC 4.1.2.13 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
32% identity, 88% coverage: 31:298/303 of query aligns to 21:276/281 of P58314
P0A991 Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; EC 4.1.2.13 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 96% coverage: 8:299/303 of query aligns to 46:349/350 of P0A991
Sites not aligning to the query:
2qjgA M. Jannaschii adh synthase complexed with f1,6p (see paper)
29% identity, 53% coverage: 142:302/303 of query aligns to 109:272/272 of 2qjgA
Sites not aligning to the query:
>WP_109967688.1 NCBI__GCF_003173355.1:WP_109967688.1
MSKSIYVPLDVPKDQQKTYTSNFKTITHESGRLMLFAGDQKIEHLNADFFGDGIHKDDND
PEHLFRIAAKAKIGCFATQLGLIARYGADYPDVPYLVKINSKTNLVGTSQQEPSSGLLNT
VEQVVRFRKSSGLKIGGIGYTIYLGSEAESEMLSAAANAIFEAHQNGLVTVLWIYPRGKA
VKDEKDPHLIAGAAGVAACLGSDFVKVNPPKKEGASSVELMKEATLAAGRTKVVCAGGSS
VDGEIFLKQLWEQIHIGGCAGNATGRNIHQKSLDEAVRMCNAIYAITVQDASIEEAVKIY
EKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory