Comparing WP_109968318.1 NCBI__GCF_003173355.1:WP_109968318.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P14407 Fumarate hydratase class I, anaerobic; D-tartrate dehydratase; Fumarase B; EC 4.2.1.2; EC 4.2.1.81 from Escherichia coli (strain K12) (see paper)
25% identity, 92% coverage: 19:276/279 of query aligns to 53:328/548 of P14407
6msoA Crystal structure of mitochondrial fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
26% identity, 79% coverage: 53:272/279 of query aligns to 88:325/540 of 6msoA
Sites not aligning to the query:
Q4QAU9 Fumarate hydratase 1, mitochondrial; Fumarase 1; LmFH-1; EC 4.2.1.2 from Leishmania major (see paper)
26% identity, 79% coverage: 53:272/279 of query aligns to 97:334/549 of Q4QAU9
E9AE57 Fumarate hydratase 2; Fumarase 2; LmFH-2; EC 4.2.1.2 from Leishmania major (see paper)
28% identity, 89% coverage: 31:279/279 of query aligns to 93:359/568 of E9AE57
Sites not aligning to the query:
6unzA Crystal structure of cytosolic fumarate hydratase from leishmania major (see paper)
28% identity, 89% coverage: 31:279/279 of query aligns to 73:339/539 of 6unzA
Sites not aligning to the query:
6uoiA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with malonate (see paper)
28% identity, 89% coverage: 31:279/279 of query aligns to 68:334/535 of 6uoiA
Sites not aligning to the query:
6msnA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
28% identity, 89% coverage: 31:279/279 of query aligns to 66:332/532 of 6msnA
Sites not aligning to the query:
6uqnB Crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with fumarate and s-malate (see paper)
27% identity, 89% coverage: 31:279/279 of query aligns to 66:332/532 of 6uqnB
Sites not aligning to the query:
>WP_109968318.1 NCBI__GCF_003173355.1:WP_109968318.1
MSSPVPPDLSDRIAAATANAIRIAEITLPPDVLERIVAASEDETSPVARRELMHILENIR
LADERQAPICQDTGIPVIYLTLPPQIPFSSEIVDAVRKGVREATVTIPLRPNLVDPITRH
NTGTNTSADMPAVHILPGDRMQVTVLPKGAGSENVSRLKMFTPTEKDRIPEFIVETALLA
GGRPCPPIILGVGIGGTFDGAASLAKEALLEPLDQMTPEEMEICQKVNDLGIGPMGLGGK
TTCLGVKIKSAGCHTASLPVAVNIQCWAARRATVEVPLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory