Comparing WP_109968409.1 NCBI__GCF_003173355.1:WP_109968409.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6n2oC 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
37% identity, 98% coverage: 1:358/365 of query aligns to 202:569/572 of 6n2oC
Sites not aligning to the query:
6n2oA 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
37% identity, 98% coverage: 1:358/365 of query aligns to 202:569/572 of 6n2oA
Sites not aligning to the query:
6n2nA Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
37% identity, 98% coverage: 1:358/365 of query aligns to 202:569/572 of 6n2nA
5b48A 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
32% identity, 84% coverage: 1:308/365 of query aligns to 200:511/576 of 5b48A
P72578 2-oxoacid:ferredoxin oxidoreductase subunit alpha; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see 2 papers)
31% identity, 84% coverage: 1:308/365 of query aligns to 232:559/632 of P72578
Q96Y66 2-oxoacid:ferredoxin oxidoreductase 1, subunit alpha; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
31% identity, 84% coverage: 1:308/365 of query aligns to 232:559/627 of Q96Y66
Sites not aligning to the query:
Q96XT2 2-oxoacid:ferredoxin oxidoreductase 2, subunit alpha; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
31% identity, 87% coverage: 1:316/365 of query aligns to 233:568/628 of Q96XT2
5b47A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
31% identity, 87% coverage: 1:316/365 of query aligns to 232:567/627 of 5b47A
5b46A 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
31% identity, 87% coverage: 1:316/365 of query aligns to 232:567/627 of 5b46A
5exeA Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
22% identity, 99% coverage: 1:360/365 of query aligns to 6:375/394 of 5exeA
5exdD Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
22% identity, 99% coverage: 1:360/365 of query aligns to 6:375/394 of 5exdD
5c4iA Structure of an oxalate oxidoreductase (see paper)
22% identity, 99% coverage: 1:360/365 of query aligns to 6:375/394 of 5c4iA
>WP_109968409.1 NCBI__GCF_003173355.1:WP_109968409.1
MQGNIACAEGALAADCTFFAGYPITPSTEVAEHMAAKLPKRNGCFIQMEDEIASMAAIIG
AAWTGVRAMTATSGPGFSLMMENIGYAVMSETPCVLVNVQRGGPSTGQPTMAAQGDMMQV
RFGSHGDFSIIALSPSTVQECFELTAKAFNLADQFRCPVFVMADEVIGHMRERITIPDSV
PVVRAKPLKDDMLPFAPEEDLIPGFAAFGTGRKIPVTGLTHNEKGYPDSTHPARHDSLVR
RLVNKIENARHSIADYEIVNQDAEYVFVCYGSPVRTVQEVVQRAKTPGTGYLKLKIVWPF
PEDLLARFPNVKAFIVPELNLGMISREIERHVCVPVISAGKIGGDLHTPDELIAIVEKLR
GGGGI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory