Comparing WP_109969236.1 NCBI__GCF_003173355.1:WP_109969236.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
B0SR19 Sugar transporter SemiSWEET from Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (see paper)
43% identity, 88% coverage: 8:81/84 of query aligns to 6:79/85 of B0SR19
5uhsA Structure of a semisweet d57a mutant (see paper)
43% identity, 88% coverage: 8:81/84 of query aligns to 6:79/81 of 5uhsA
P0DMV3 Sugar transporter SemiSWEET from Escherichia coli (strain UMEA 3162-1) (see paper)
39% identity, 94% coverage: 1:79/84 of query aligns to 1:79/89 of P0DMV3
>WP_109969236.1 NCBI__GCF_003173355.1:WP_109969236.1
MDLFHATGYIAAFCSTVAFLPQVWQTYKTRHAHDISYGMLLLLMTGMTLWLIYGVVIGEL
PVILANGITLILLATITVMKIRYP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory