SitesBLAST
Comparing WP_110803739.1 NCBI__GCF_003217355.1:WP_110803739.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
46% identity, 84% coverage: 5:199/233 of query aligns to 6:178/193 of 2vpyF
- binding pentachlorophenol: I91 (≠ M106), C93 (= C108)
- binding iron/sulfur cluster: C13 (= C12), G15 (= G14), C16 (= C15), C19 (= C18), C23 (= C22), N27 (= N29), L36 (≠ N50), I38 (≠ V52), P55 (= P70), Q57 (≠ T72), C58 (= C73), L59 (≠ V74), C61 (= C76), P65 (= P80), C66 (= C81), C70 (= C85), P71 (= P86), V83 (= V98), C90 (= C105), I91 (≠ M106), A92 (≠ G107), C93 (= C108), G94 (= G109), C96 (= C111), C100 (= C115), P101 (= P116), Y102 (= Y117), R105 (= R120), V113 (≠ M129), C116 (= C132), F118 (≠ L134), C119 (= C135), P129 (= P151), A130 (= A152), C131 (= C153), C135 (= C157), C139 (≠ A161), R140 (= R162)
Sites not aligning to the query:
2vpwF Polysulfide reductase with bound menaquinone (see paper)
46% identity, 84% coverage: 5:199/233 of query aligns to 6:178/193 of 2vpwF
- binding iron/sulfur cluster: C13 (= C12), G15 (= G14), C16 (= C15), C19 (= C18), C23 (= C22), N27 (= N29), L36 (≠ N50), I38 (≠ V52), P55 (= P70), Q57 (≠ T72), C58 (= C73), L59 (≠ V74), H60 (= H75), C61 (= C76), P65 (= P80), C66 (= C81), C70 (= C85), P71 (= P86), V83 (= V98), C90 (= C105), I91 (≠ M106), A92 (≠ G107), C93 (= C108), G94 (= G109), C96 (= C111), C100 (= C115), P101 (= P116), Y102 (= Y117), R105 (= R120), V113 (≠ M129), C116 (= C132), F118 (≠ L134), C119 (= C135), P129 (= P151), A130 (= A152), C131 (= C153), C135 (= C157), C139 (≠ A161), R140 (= R162)
Sites not aligning to the query:
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
33% identity, 82% coverage: 5:195/233 of query aligns to 7:180/205 of P18776
- C102 (= C108) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kqfB Formate dehydrogenase n from e. Coli (see paper)
32% identity, 76% coverage: 6:182/233 of query aligns to 32:206/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (≠ L110)
- binding iron/sulfur cluster: C38 (= C12), I39 (≠ T13), G40 (= G14), C41 (= C15), K42 (≠ H16), C44 (= C18), C48 (= C22), N52 (≠ Q26), T77 (≠ R51), M79 (≠ H53), C99 (= C73), M100 (≠ V74), H101 (= H75), C102 (= C76), P105 (= P79), C107 (= C81), C111 (= C85), P112 (= P86), I117 (≠ S90), V125 (= V98), C132 (= C105), I133 (≠ M106), G134 (= G107), C135 (= C108), G136 (= G109), Y137 (≠ L110), C138 (= C111), C142 (= C115), I146 (≠ A119), P147 (≠ R120), V156 (≠ M129), K158 (= K131), C159 (= C132), L161 (= L134), C162 (= C135), P172 (= P151), C174 (= C153), C178 (= C157), P179 (= P158), I183 (≠ R162)
Sites not aligning to the query:
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
32% identity, 76% coverage: 6:182/233 of query aligns to 33:207/294 of P0AAJ3
- C39 (= C12) binding [4Fe-4S] cluster
- C42 (= C15) binding [4Fe-4S] cluster
- C45 (= C18) binding [4Fe-4S] cluster
- C49 (= C22) binding [4Fe-4S] cluster
- C100 (= C73) binding [4Fe-4S] cluster
- C103 (= C76) binding [4Fe-4S] cluster
- C108 (= C81) binding [4Fe-4S] cluster
- C112 (= C85) binding [4Fe-4S] cluster
- C133 (= C105) binding [4Fe-4S] cluster
- C136 (= C108) binding [4Fe-4S] cluster
- C139 (= C111) binding [4Fe-4S] cluster
- C143 (= C115) binding [4Fe-4S] cluster
- C160 (= C132) binding [4Fe-4S] cluster
- C163 (= C135) binding [4Fe-4S] cluster
- C175 (= C153) binding [4Fe-4S] cluster
- C179 (= C157) binding [4Fe-4S] cluster
6f0kB Alternative complex iii (see paper)
31% identity, 84% coverage: 5:199/233 of query aligns to 726:948/961 of 6f0kB
- binding fe3-s4 cluster: C803 (= C85), V805 (≠ T87), M818 (≠ I100), C823 (= C105), I824 (≠ M106), G825 (= G107), C829 (= C111), M869 (= M129)
- binding heme c: N821 (≠ K103), R822 (= R104), R884 (= R144), N887 (≠ E147)
- binding iron/sulfur cluster: C733 (= C12), T734 (= T13), G735 (= G14), C736 (= C15), N737 (≠ H16), A738 (= A17), C739 (= C18), C743 (= C22), W765 (≠ G46), I768 (≠ L49), C791 (= C73), M792 (≠ V74), H793 (= H75), C794 (= C76), P798 (= P80), C799 (= C81), N816 (≠ V98), C833 (= C115), C872 (= C132), Y874 (≠ L134), C875 (= C135), A901 (= A152), C902 (= C153), C906 (= C157)
Sites not aligning to the query:
6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
29% identity, 85% coverage: 1:199/233 of query aligns to 1:225/234 of 6cz7B
- binding iron/sulfur cluster: C12 (= C12), V13 (≠ T13), G14 (= G14), C15 (= C15), G16 (≠ H16), C18 (= C18), C22 (= C22), N26 (≠ Q26), Y52 (= Y55), P54 (= P70), C57 (= C73), N58 (≠ V74), H59 (= H75), C60 (= C76), A63 (≠ P79), P64 (= P80), C65 (= C81), C69 (= C85), P70 (= P86), T82 (≠ V98), C89 (= C105), I90 (≠ M106), G91 (= G107), C92 (= C108), K93 (≠ G109), C95 (= C111), C99 (= C115), Y101 (= Y117), V103 (≠ A119), I104 (≠ R120), T161 (vs. gap), K163 (= K131), C164 (= C132), F166 (≠ L134), C167 (= C135), C179 (= C153), C183 (= C157), P184 (= P158), R188 (= R162)
Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
29% identity, 85% coverage: 1:199/233 of query aligns to 1:225/234 of Q7WTT9
- C12 (= C12) binding [4Fe-4S] cluster
- C15 (= C15) binding [4Fe-4S] cluster
- C18 (= C18) binding [4Fe-4S] cluster
- C22 (= C22) binding [4Fe-4S] cluster
- C57 (= C73) binding [4Fe-4S] cluster
- C60 (= C76) binding [4Fe-4S] cluster
- C65 (= C81) binding [4Fe-4S] cluster
- C69 (= C85) binding [4Fe-4S] cluster
- C89 (= C105) binding [4Fe-4S] cluster
- C92 (= C108) binding [4Fe-4S] cluster
- C95 (= C111) binding [4Fe-4S] cluster
- C99 (= C115) binding [4Fe-4S] cluster
- C164 (= C132) binding [4Fe-4S] cluster
- C167 (= C135) binding [4Fe-4S] cluster
- C179 (= C153) binding [4Fe-4S] cluster
- C183 (= C157) binding [4Fe-4S] cluster
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
38% identity, 58% coverage: 66:201/233 of query aligns to 129:260/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C85), T150 (= T87), I153 (≠ S90), C169 (= C105), K170 (≠ M106), G171 (= G107), H172 (≠ C108), R173 (≠ G109), H174 (≠ L110), C175 (= C111), S193 (≠ M129)
- binding protoporphyrin ix containing fe: T150 (= T87), K170 (≠ M106), H172 (≠ C108)
- binding iron/sulfur cluster: M135 (≠ T72), C136 (= C73), N137 (≠ V74), H138 (= H75), C139 (= C76), P142 (= P79), C144 (= C81), V162 (= V98), C179 (= C115), A183 (= A119), I184 (≠ R120), K195 (= K131), C196 (= C132), I197 (≠ T133), L198 (= L134), C199 (= C135), N209 (≠ P151), C211 (= C153), C215 (= C157), V219 (≠ A161), R220 (= R162)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41
8k9fB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 2.9 angstrom (see paper)
29% identity, 84% coverage: 5:199/233 of query aligns to 712:939/951 of 8k9fB
- binding fe3-s4 cluster: C787 (= C85), P788 (= P86), M802 (≠ I100), C807 (= C105), G809 (= G107), T810 (≠ C108), K811 (≠ G109), Y812 (≠ L110), C813 (= C111)
- binding heme c: N805 (≠ K103), R806 (= R104), R867 (= R144), K871 (≠ D148)
- binding iron/sulfur cluster: C719 (= C12), G721 (= G14), C722 (= C15), N723 (≠ H16), C725 (= C18), C729 (= C22), N733 (≠ Q26), W751 (≠ G46), I752 (≠ A47), P772 (= P70), C775 (= C73), M776 (≠ V74), Q777 (≠ H75), C778 (= C76), C783 (= C81), N800 (≠ V98), C817 (= C115), Y819 (= Y117), V821 (≠ A119), C856 (= C132), Y858 (≠ L134), C859 (= C135), T891 (≠ P151), C893 (= C153), C897 (= C157), P898 (= P158), T899 (= T159)
Sites not aligning to the query:
8k9eB Cryo-em structure of the photosynthetic alternative complex iii from chloroflexus aurantiacus at 3.3 angstrom (see paper)
29% identity, 84% coverage: 5:199/233 of query aligns to 712:939/951 of 8k9eB
- binding fe3-s4 cluster: C787 (= C85), M802 (≠ I100), C807 (= C105), V808 (≠ M106), G809 (= G107), T810 (≠ C108), K811 (≠ G109), Y812 (≠ L110), C813 (= C111), M853 (= M129)
- binding heme c: N805 (≠ K103), R867 (= R144), K871 (≠ D148)
- binding iron/sulfur cluster: C719 (= C12), I720 (≠ T13), G721 (= G14), C722 (= C15), N723 (≠ H16), C725 (= C18), C729 (= C22), N733 (≠ Q26), I754 (≠ L49), C775 (= C73), M776 (≠ V74), C778 (= C76), P782 (= P80), C783 (= C81), N800 (≠ V98), C817 (= C115), Y819 (= Y117), V821 (≠ A119), R822 (= R120), C856 (= C132), Y858 (≠ L134), C859 (= C135), T891 (≠ P151), C893 (= C153), C897 (= C157), T899 (= T159)
Sites not aligning to the query:
6lodB Cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii (see paper)
28% identity, 84% coverage: 5:199/233 of query aligns to 685:917/929 of 6lodB
- binding fe3-s4 cluster: V758 (= V84), C759 (= C85), P760 (= P86), C779 (= C105), V780 (≠ M106), G781 (= G107), T782 (≠ C108), C785 (= C111), M838 (= M129)
- binding heme c: N777 (≠ K103), R778 (= R104), R852 (vs. gap), I853 (vs. gap), R856 (= R144)
- binding iron/sulfur cluster: C692 (= C12), N693 (≠ T13), S694 (≠ G14), C695 (= C15), N696 (≠ H16), A697 (= A17), C698 (= C18), C702 (= C22), N706 (= N29), W724 (≠ A47), I727 (≠ V52), L746 (≠ T72), C747 (= C73), Q748 (≠ V74), Q749 (≠ H75), C750 (= C76), P754 (= P80), C755 (= C81), N772 (≠ V98), C789 (= C115), Y791 (= Y117), V793 (≠ A119), R794 (= R120), K840 (= K131), C841 (= C132), F843 (≠ L134), C844 (= C135), T869 (≠ P151), C871 (= C153), C875 (= C157), I880 (≠ R162)
5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
34% identity, 58% coverage: 66:201/233 of query aligns to 126:257/329 of 5ch7B
- binding fe3-s4 cluster: C145 (= C85), I150 (≠ S90), C166 (= C105), K167 (≠ M106), G168 (= G107), A169 (≠ C108), Q170 (≠ G109), A171 (≠ L110), C172 (= C111), A190 (≠ M129)
- binding iron/sulfur cluster: P130 (= P70), C133 (= C73), N134 (≠ V74), C136 (= C76), P139 (= P79), C141 (= C81), C176 (= C115), C193 (= C132), G195 (≠ L134), C196 (= C135), C208 (= C153), C212 (= C157), V213 (≠ P158), G214 (≠ T159)
Sites not aligning to the query:
4v4cB Pyrogallol hydroxytransferase small subunit (see paper)
30% identity, 89% coverage: 5:212/233 of query aligns to 6:204/274 of 4v4cB
- binding calcium ion: I61 (= I67), N62 (≠ H68)
- binding iron/sulfur cluster: C13 (= C12), Q14 (≠ T13), D15 (≠ G14), C16 (= C15), N17 (≠ H16), N18 (≠ A17), C19 (= C18), C23 (= C22), C68 (= C73), M69 (≠ V74), H70 (= H75), C71 (= C76), C76 (= C81), V92 (= V98), C109 (= C115), V113 (≠ A119), C126 (= C132), M128 (≠ L134), C129 (= C135), P143 (= P151), C145 (= C153), C149 (= C157), S151 (≠ T159), V153 (≠ A161), Y154 (≠ R162)
6btmB Structure of alternative complex iii from flavobacterium johnsoniae (wild type) (see paper)
27% identity, 83% coverage: 5:198/233 of query aligns to 686:942/948 of 6btmB
- binding fe3-s4 cluster: C789 (= C85), C809 (= C105), V810 (≠ M106), T812 (≠ C108), C815 (= C111), M862 (= M129)
- binding iron/sulfur cluster: C777 (= C73), Q778 (≠ V74), C780 (= C76), C785 (= C81), N802 (≠ V98), C819 (= C115), R824 (= R120)
Sites not aligning to the query:
8cm6D W-formate dehydrogenase c872a from desulfovibrio vulgaris - with formamide (see paper)
28% identity, 72% coverage: 3:169/233 of query aligns to 2:168/214 of 8cm6D
- binding formamide: R59 (≠ A59), P62 (≠ T62)
- binding iron/sulfur cluster: F4 (≠ L5), C11 (= C12), T12 (= T13), A13 (≠ G14), C14 (= C15), R15 (≠ H16), C17 (= C18), C21 (= C22), K25 (≠ Q26), K50 (≠ N50), C73 (= C73), R74 (≠ V74), C76 (= C76), P79 (= P79), P80 (= P80), C81 (= C81), V102 (≠ L97), C120 (= C115), I124 (≠ A119), P125 (≠ R120), K136 (= K131), C137 (= C132), D138 (≠ T133), M139 (≠ L134), C140 (= C135), C152 (= C153), C156 (= C157), P157 (= P158), T158 (= T159), T160 (≠ A161), M161 (≠ R162)
8bqgB W-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 1 min (see paper)
28% identity, 72% coverage: 3:169/233 of query aligns to 2:168/214 of 8bqgB
- binding iron/sulfur cluster: F4 (≠ L5), C11 (= C12), T12 (= T13), A13 (≠ G14), C14 (= C15), R15 (≠ H16), C17 (= C18), C21 (= C22), K25 (≠ Q26), K50 (≠ N50), C73 (= C73), R74 (≠ V74), C76 (= C76), P80 (= P80), C81 (= C81), V102 (≠ L97), C120 (= C115), I124 (≠ A119), P125 (≠ R120), K136 (= K131), C137 (= C132), M139 (≠ L134), C140 (= C135), C152 (= C153), C156 (= C157), P157 (= P158), T158 (= T159), T160 (≠ A161), M161 (≠ R162)
7b04A of Nitrite oxidoreductase (Nxr) from the anammox bacterium Kuenenia stuttgartiensis.
34% identity, 59% coverage: 66:202/233 of query aligns to 167:308/409 of 7b04A
- binding fe3-s4 cluster: C186 (= C85), I191 (≠ S90), C207 (= C105), R208 (≠ M106), G209 (= G107), Y210 (≠ C108), R211 (≠ G109), K212 (≠ L110), C213 (= C111), S231 (≠ M129)
- binding protoporphyrin ix containing fe: R188 (≠ T87), R208 (≠ M106), Y210 (≠ C108)
- binding iron/sulfur cluster: Q171 (≠ P70), I173 (≠ T72), C174 (= C73), N175 (≠ V74), H176 (= H75), C177 (= C76), P180 (= P79), C182 (= C81), C217 (= C115), P222 (≠ R120), K233 (= K131), C234 (= C132), A236 (≠ L134), C237 (= C135), T255 (≠ D148), R256 (= R149), C257 (= C153), C261 (= C157), V262 (≠ P158), I265 (≠ A161), R266 (= R162)
Sites not aligning to the query:
- binding iron/sulfur cluster: 34, 35, 36, 37, 38, 40, 44, 48, 59, 60, 62
Q8GC87 Formate dehydrogenase subunit beta; FDH subunit beta; Formate dehydrogenase small subunit from Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) (Desulfovibrio gigas) (see paper)
28% identity, 79% coverage: 1:185/233 of query aligns to 1:186/215 of Q8GC87
- C12 (= C12) binding [4Fe-4S] cluster
- C15 (= C15) binding [4Fe-4S] cluster
- C18 (= C18) binding [4Fe-4S] cluster
- C22 (= C22) binding [4Fe-4S] cluster
- C73 (= C73) binding [4Fe-4S] cluster
- C76 (= C76) binding [4Fe-4S] cluster
- C81 (= C81) binding [4Fe-4S] cluster
- C121 (= C115) binding [4Fe-4S] cluster
- C138 (= C132) binding [4Fe-4S] cluster
- C141 (= C135) binding [4Fe-4S] cluster
- C153 (= C153) binding [4Fe-4S] cluster
- C157 (= C157) binding [4Fe-4S] cluster
1h0hB Tungsten containing formate dehydrogenase from desulfovibrio gigas (see paper)
28% identity, 79% coverage: 2:185/233 of query aligns to 1:185/214 of 1h0hB
- binding iron/sulfur cluster: F4 (≠ L5), C11 (= C12), T12 (= T13), A13 (≠ G14), C14 (= C15), R15 (≠ H16), C17 (= C18), C21 (= C22), H25 (≠ N27), K50 (vs. gap), Q71 (≠ T72), C72 (= C73), R73 (≠ V74), C75 (= C76), P79 (= P80), C80 (= C81), V101 (≠ M106), C120 (= C115), P125 (≠ R120), K136 (= K131), C137 (= C132), D138 (≠ T133), M139 (≠ L134), C140 (= C135), C152 (= C153), C156 (= C157), P157 (= P158), A160 (= A161)
Query Sequence
>WP_110803739.1 NCBI__GCF_003217355.1:WP_110803739.1
MSRTLVIDLDSCTGCHACTIACKGWQNANEDTRLPDAEAYGAAPFGAFLNRVHSYEVIAD
DTPARLIHYPRTCVHCENPPCVPVCPTGASHQTADGLVQIDAKRCMGCGLCAWACPYGAR
ELDPVAGVMRKCTLCANRIDDPARPAEDRIPACVRACPTGARHFGDPTDAESPLGRLVAA
RGGFAPMPEFGTKPTSRYLPPRPKDRLGAGAVPTPLVPGGGLQVWLDKLLGRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory