Comparing WP_110804301.1 NCBI__GCF_003217355.1:WP_110804301.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9ZU52 Fructose-bisphosphate aldolase 3, chloroplastic; AtFBA3; Protein PIGMENT DEFECTIVE 345; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 89% coverage: 1:262/294 of query aligns to 48:331/391 of Q9ZU52
Sites not aligning to the query:
Q8I8I2 Fructose-bisphosphate aldolase 1; TgALD; TgALD1; TgAldolase; EC 4.1.2.13 from Toxoplasma gondii (see 2 papers)
30% identity, 68% coverage: 1:201/294 of query aligns to 12:214/363 of Q8I8I2
Sites not aligning to the query:
5tklA Crystal structure of fbp aldolase from toxoplasma gondii, condensation intermediate (see paper)
30% identity, 68% coverage: 1:201/294 of query aligns to 12:214/350 of 5tklA
Sites not aligning to the query:
Q9SJU4 Fructose-bisphosphate aldolase 1, chloroplastic; AtFBA1; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 89% coverage: 1:263/294 of query aligns to 56:342/399 of Q9SJU4
Sites not aligning to the query:
Q944G9 Fructose-bisphosphate aldolase 2, chloroplastic; AtFBA2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 89% coverage: 1:263/294 of query aligns to 55:341/398 of Q944G9
Sites not aligning to the query:
6rngB Dipeptide gly-pro binds to a glycolytic enzyme fructose bisphosphate aldolase
29% identity, 64% coverage: 12:199/294 of query aligns to 18:201/334 of 6rngB
Sites not aligning to the query:
Q9SJQ9 Fructose-bisphosphate aldolase 6, cytosolic; AtFBA6; Cytosolic aldolase 2; cAld2; EC 4.1.2.13 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 64% coverage: 12:199/294 of query aligns to 23:206/358 of Q9SJQ9
2ephD Crystal structure of fructose-bisphosphate aldolase from plasmodium falciparum in complex with trap-tail determined at 2.7 angstrom resolution (see paper)
27% identity, 68% coverage: 1:199/294 of query aligns to 19:215/351 of 2ephD
Sites not aligning to the query:
P14223 Fructose-bisphosphate aldolase; PfAldo; 41 kDa antigen; EC 4.1.2.13 from Plasmodium falciparum (see paper)
27% identity, 68% coverage: 1:199/294 of query aligns to 22:218/369 of P14223
Sites not aligning to the query:
4tr9A Ternary co-crystal structure of fructose-bisphosphate aldolase from plasmodium falciparum in complex with trap and a small molecule inhibitor (see paper)
27% identity, 68% coverage: 1:199/294 of query aligns to 17:213/347 of 4tr9A
Sites not aligning to the query:
2qdhA Fructose-1,6-bisphosphate aldolase from leishmania mexicana in complex with mannitol-1,6-bisphosphate, a competitive inhibitor (see paper)
29% identity, 60% coverage: 12:188/294 of query aligns to 36:209/366 of 2qdhA
Sites not aligning to the query:
2qdgA Fructose-1,6-bisphosphate schiff base intermediate in fbp aldolase from leishmania mexicana (see paper)
29% identity, 60% coverage: 12:188/294 of query aligns to 36:209/366 of 2qdgA
Sites not aligning to the query:
2ot0A Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a c-terminal peptide of wiskott-aldrich syndrome protein (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 26:190/356 of 2ot0A
Sites not aligning to the query:
5tlzA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor naphthalene 2,6-bisphosphate (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 23:187/346 of 5tlzA
Sites not aligning to the query:
5tlwA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 1-phosphate-benzene 4-bisphosphonate (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 26:190/349 of 5tlwA
Sites not aligning to the query:
5tleA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor 2-phosphate-naphthalene 6-bisphosphonate (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 26:190/349 of 5tleA
Sites not aligning to the query:
3tu9A Crystal structure of rabbit muscle aldolase bound with 5-o-methyl mannitol 1,6-phosphate (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 26:190/349 of 3tu9A
Sites not aligning to the query:
2ot1A Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with naphthol as-e phosphate, a competitive inhibitor (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 26:190/349 of 2ot1A
Sites not aligning to the query:
1zalA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially disordered tagatose-1,6-bisphosphate, a weak competitive inhibitor (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 26:190/363 of 1zalA
Sites not aligning to the query:
1zajA Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with mannitol-1,6-bisphosphate, a competitive inhibitor (see paper)
32% identity, 57% coverage: 12:179/294 of query aligns to 26:190/363 of 1zajA
Sites not aligning to the query:
>WP_110804301.1 NCBI__GCF_003217355.1:WP_110804301.1
MAKTMMEHMRKGEGFIAALDQSGGSTPKALRLYGITEDAYSNETEMYDLIHAMRARIIKS
SAFTGDKVVGAILFEQTMDRDIDGIPTATYLWEKRGVVPFLKIDKGLEEEKNGCQMLKAM
PTLDALLERAAEAGIFGTKERSVISAADPMGIASVVAQQFEVGEQVLGAGMVPILEPEVT
ISIADKIDAEAMLRDALLAGLETVSSPVMLKLSLPTIDNFYLPLVEHPNVIKVVALSGGY
ARNDANAILARNKGMIASFSRALTEGLTAQMTDAEFDAALGEAIDSIYRASIAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory