SitesBLAST
Comparing WP_110805778.1 NCBI__GCF_003217355.1:WP_110805778.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P05414 Glycolate oxidase; GAO; GOX; Short chain alpha-hydroxy acid oxidase; EC 1.1.3.15 from Spinacia oleracea (Spinach) (see 4 papers)
37% identity, 96% coverage: 4:376/387 of query aligns to 3:354/369 of P05414
- Y24 (= Y25) mutation to F: 10-fold decrease in affinity for glycolate.
- PTA 77:79 (≠ PVG 78:80) binding FMN
- S106 (= S107) binding FMN
- W108 (≠ M109) mutation to S: 100-fold decrease in affinity for glycolate and 500-fold decrease in activity.
- QLY 127:129 (= QLY 128:130) binding FMN
- T155 (= T156) binding FMN
- K230 (= K252) binding FMN
- S252 (= S274) binding FMN
- DGGVR 285:289 (≠ DSGIR 307:311) binding FMN
- GR 308:309 (= GR 330:331) binding FMN
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
1al7A Three-dimensional structures of glycolate oxidase with bound active- site inhibitors (see paper)
37% identity, 96% coverage: 4:376/387 of query aligns to 3:345/350 of 1al7A
- active site: S106 (= S107), Y129 (= Y130), T155 (= T156), D157 (= D158), K221 (= K252), H245 (= H276)
- binding flavin mononucleotide: Y24 (= Y25), Y25 (≠ C26), P77 (= P78), T78 (≠ V79), A79 (≠ G80), S106 (= S107), Q127 (= Q128), T155 (= T156), K221 (= K252), H245 (= H276), R248 (= R279), D276 (= D307), G277 (≠ S308), R280 (= R311), G299 (= G330), R300 (= R331)
- binding 4-carboxy-5-(1-pentyl)hexylsulfanyl-1,2,3-triazole: Y24 (= Y25), W108 (≠ M109), Y129 (= Y130), R164 (= R165), F172 (≠ L173), I198 (≠ F229), H245 (= H276), R248 (= R279)
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
36% identity, 97% coverage: 4:377/387 of query aligns to 2:349/353 of 5zbmB
- active site: Y128 (= Y130), D156 (= D158), H248 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ C26), P76 (= P78), T77 (≠ V79), W107 (≠ M109), Q126 (= Q128), Y128 (= Y130), T154 (= T156), K224 (= K252), H248 (= H276), G249 (= G277), R251 (= R279), D279 (= D307), G280 (≠ S308), R283 (= R311), G302 (= G330), R303 (= R331)
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
38% identity, 96% coverage: 7:376/387 of query aligns to 6:370/373 of 6bfgA
- active site: Y129 (= Y130), D156 (= D158), H272 (= H276)
- binding flavin mononucleotide: Y24 (= Y25), P77 (= P78), T78 (≠ V79), G79 (= G80), Q127 (= Q128), Y129 (= Y130), T154 (= T156), K248 (= K252), H272 (= H276), G273 (= G277), R275 (= R279), D301 (= D307), S302 (= S308), G303 (= G309), R305 (= R311), G324 (= G330), R325 (= R331)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
38% identity, 96% coverage: 7:376/387 of query aligns to 8:372/393 of P20932
- PTG 79:81 (≠ PVG 78:80) binding FMN
- G81 (= G80) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S107) binding FMN
- Q129 (= Q128) binding FMN
- T156 (= T156) binding FMN
- K250 (= K252) binding FMN
- DSGFR 303:307 (≠ DSGIR 307:311) binding FMN
- GR 326:327 (= GR 330:331) binding FMN
Q8Z0C8 L-lactate oxidase; LOX; Glyoxylate oxidase; No-LOX; EC 1.1.3.-; EC 1.2.3.5 from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
39% identity, 96% coverage: 1:371/387 of query aligns to 1:358/365 of Q8Z0C8
- M82 (≠ V79) mutation to T: Increases oxidation activity with both L-lactate and glycolate. Shows a 6-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- L112 (≠ M109) mutation to W: Impairs oxidation of L-lactate. Shows a 2-fold decrease in the L-lactate/glycolate oxidase activity ratio.
- F212 (≠ T225) mutation to V: Impairs oxidation of L-lactate. Shows a 27-fold decrease in the L-lactate/glycolate oxidase activity ratio.
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
34% identity, 95% coverage: 4:369/387 of query aligns to 5:351/360 of 6gmcA
- active site: Y132 (= Y130), D160 (= D158), H258 (= H276)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y25), M82 (≠ L81), W110 (≠ M109), Y132 (= Y130), R167 (= R165), F191 (≠ T189), L203 (= L221), Y206 (≠ W224), H258 (= H276), R261 (= R279)
- binding flavin mononucleotide: Y26 (= Y25), Y27 (≠ C26), A79 (≠ P78), T80 (≠ V79), A81 (≠ G80), S108 (= S107), Q130 (= Q128), Y132 (= Y130), T158 (= T156), K234 (= K252), H258 (= H276), G259 (= G277), R261 (= R279), D289 (= D307), G290 (≠ S308), R293 (= R311), G312 (= G330), R313 (= R331)
1huvA Crystal structure of a soluble mutant of the membrane-associated (s)- mandelate dehydrogenase from pseudomonas putida at 2.15a resolution (see paper)
39% identity, 96% coverage: 7:376/387 of query aligns to 5:346/349 of 1huvA
- active site: S105 (= S107), Y128 (= Y130), T153 (= T156), D155 (= D158), K224 (= K252), H248 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), P76 (= P78), T77 (≠ V79), G78 (= G80), S105 (= S107), Q126 (= Q128), Y128 (= Y130), T153 (= T156), K224 (= K252), H248 (= H276), G249 (= G277), R251 (= R279), D277 (= D307), S278 (= S308), G279 (= G309), R281 (= R311), G300 (= G330), R301 (= R331)
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
38% identity, 96% coverage: 7:376/387 of query aligns to 5:350/353 of 2a85A
- active site: S105 (= S107), Y128 (= Y130), T153 (= T156), D155 (= D158), K228 (= K252), H252 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), P76 (= P78), T77 (≠ V79), A78 (≠ G80), S105 (= S107), Q126 (= Q128), Y128 (= Y130), T153 (= T156), K228 (= K252), H252 (= H276), G253 (= G277), R255 (= R279), D281 (= D307), S282 (= S308), G283 (= G309), R285 (= R311), G304 (= G330), R305 (= R331)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y130), N159 (≠ L162), G160 (= G163), R162 (= R165), H252 (= H276), R255 (= R279)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
38% identity, 96% coverage: 7:376/387 of query aligns to 5:350/353 of 2a7pA
- active site: S105 (= S107), Y128 (= Y130), T153 (= T156), D155 (= D158), K228 (= K252), H252 (= H276)
- binding 3-(indol-3-yl) lactate: Y128 (= Y130), R162 (= R165), H252 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), P76 (= P78), T77 (≠ V79), A78 (≠ G80), S105 (= S107), Q126 (= Q128), Y128 (= Y130), T153 (= T156), K228 (= K252), H252 (= H276), G253 (= G277), R255 (= R279), D281 (= D307), S282 (= S308), G283 (= G309), R285 (= R311), G304 (= G330), R305 (= R331)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
34% identity, 95% coverage: 4:369/387 of query aligns to 5:353/370 of Q9UJM8
- Y26 (= Y25) binding glyoxylate
- ATA 79:81 (≠ PVG 78:80) binding FMN
- S108 (= S107) binding FMN
- Q130 (= Q128) binding FMN
- Y132 (= Y130) binding glyoxylate
- T158 (= T156) binding FMN
- R167 (= R165) binding glyoxylate
- K236 (= K252) binding FMN
- S258 (= S274) binding FMN
- H260 (= H276) binding glyoxylate
- R263 (= R279) binding glyoxylate
- DGGVR 291:295 (≠ DSGIR 307:311) binding FMN
- GR 314:315 (= GR 330:331) binding FMN
5qigA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z1407672867
35% identity, 95% coverage: 4:369/387 of query aligns to 2:350/359 of 5qigA
- active site: Y129 (= Y130), D157 (= D158), H257 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ C26), A76 (≠ P78), T77 (≠ V79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), T155 (= T156), K233 (= K252), H257 (= H276), G258 (= G277), R260 (= R279), D288 (= D307), G289 (≠ S308), G290 (= G309), R292 (= R311), G311 (= G330), R312 (= R331)
- binding 2-cyclopropyl-1~{H}-imidazole-4-carboxamide: L2 (≠ I4), R223 (= R242), G248 (= G267), F320 (≠ A339), K324 (≠ A343), D328 (≠ K347)
5qifA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z31792168
35% identity, 95% coverage: 4:369/387 of query aligns to 2:350/359 of 5qifA
- active site: Y129 (= Y130), D157 (= D158), H257 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ C26), A76 (≠ P78), T77 (≠ V79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), K233 (= K252), H257 (= H276), G258 (= G277), R260 (= R279), D288 (= D307), G289 (≠ S308), R292 (= R311), G311 (= G330), R312 (= R331)
- binding 2-cyclohexyl-~{N}-pyridin-3-yl-ethanamide: R223 (= R242), R224 (≠ D243), S227 (≠ G246)
2rdwA Crystal structure of human glycolate oxidase in complex with sulfate (see paper)
35% identity, 95% coverage: 4:369/387 of query aligns to 2:350/359 of 2rdwA
- active site: S105 (= S107), Y129 (= Y130), T155 (= T156), D157 (= D158), K233 (= K252), H257 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ C26), A76 (≠ P78), T77 (≠ V79), A78 (≠ G80), Q127 (= Q128), Y129 (= Y130), T155 (= T156), K233 (= K252), H257 (= H276), G258 (= G277), R260 (= R279), D288 (= D307), G289 (≠ S308), R292 (= R311), G311 (= G330), R312 (= R331)
- binding sulfate ion: Y23 (= Y25), W107 (≠ M109), R164 (= R165), H257 (= H276), R260 (= R279)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
35% identity, 95% coverage: 4:369/387 of query aligns to 3:351/360 of 2rduA
- active site: S106 (= S107), Y130 (= Y130), T156 (= T156), D158 (= D158), K234 (= K252), H258 (= H276)
- binding flavin mononucleotide: Y24 (= Y25), Y25 (≠ C26), A77 (≠ P78), T78 (≠ V79), A79 (≠ G80), S106 (= S107), Q128 (= Q128), Y130 (= Y130), T156 (= T156), K234 (= K252), H258 (= H276), G259 (= G277), R261 (= R279), D289 (= D307), G290 (≠ S308), G291 (= G309), R293 (= R311), G312 (= G330), R313 (= R331)
- binding glyoxylic acid: Y24 (= Y25), W108 (≠ M109), Y130 (= Y130), R165 (= R165), H258 (= H276), R261 (= R279)
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
35% identity, 95% coverage: 4:369/387 of query aligns to 5:353/362 of 6gmbA
- active site: Y132 (= Y130), D160 (= D158), H260 (= H276)
- binding flavin mononucleotide: Y26 (= Y25), Y27 (≠ C26), A79 (≠ P78), T80 (≠ V79), A81 (≠ G80), S108 (= S107), Q130 (= Q128), Y132 (= Y130), K236 (= K252), H260 (= H276), G261 (= G277), R263 (= R279), D291 (= D307), G292 (≠ S308), G293 (= G309), R295 (= R311), G314 (= G330), R315 (= R331)
- binding glycolic acid: Y26 (= Y25), W110 (≠ M109), Y132 (= Y130), R167 (= R165), H260 (= H276), R263 (= R279)
1al8A Three-dimensional structure of glycolate oxidase with bound active- site inhibitors (see paper)
35% identity, 96% coverage: 4:376/387 of query aligns to 3:339/344 of 1al8A
- active site: S106 (= S107), Y129 (= Y130), T155 (= T156), D157 (= D158), K215 (= K252), H239 (= H276)
- binding 3-decyl-2,5-dioxo-4-hydroxy-3-pyrroline: Y24 (= Y25), W108 (≠ M109), Y129 (= Y130), F166 (≠ L173), H239 (= H276), R242 (= R279)
- binding flavin mononucleotide: Y25 (≠ C26), P77 (= P78), T78 (≠ V79), A79 (≠ G80), S106 (= S107), Q127 (= Q128), Y129 (= Y130), T155 (= T156), K215 (= K252), H239 (= H276), R242 (= R279), D270 (= D307), G271 (≠ S308), R274 (= R311), G293 (= G330), R294 (= R331)
7r4nA Structure of human hydroxyacid oxidase 1 bound with 5-bromo-n-methyl- 1h-indazole-3-carboxamide
34% identity, 95% coverage: 4:369/387 of query aligns to 4:343/352 of 7r4nA
- binding 5-bromanyl-N-methyl-1H-indazole-3-carboxamide: Y25 (= Y25), A80 (≠ G80), M81 (≠ L81), W109 (≠ M109), Y131 (= Y130), R166 (= R165), M182 (≠ P181), H250 (= H276), R253 (= R279)
- binding flavin mononucleotide: Y25 (= Y25), Y26 (≠ C26), A78 (≠ P78), T79 (≠ V79), A80 (≠ G80), S107 (= S107), W109 (≠ M109), Q129 (= Q128), Y131 (= Y130), T157 (= T156), K226 (= K252), H250 (= H276), G251 (= G277), R253 (= R279), D281 (= D307), G282 (≠ S308), R285 (= R311), G304 (= G330), R305 (= R331)
5qieA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2856434894
34% identity, 95% coverage: 4:369/387 of query aligns to 2:344/353 of 5qieA
- active site: Y129 (= Y130), D157 (= D158), H251 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ C26), A76 (≠ P78), T77 (≠ V79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), K227 (= K252), H251 (= H276), G252 (= G277), R254 (= R279), D282 (= D307), G283 (≠ S308), R286 (= R311), G305 (= G330), R306 (= R331)
- binding ~{N},~{N}-dimethyl-4-[(propan-2-ylamino)methyl]aniline: I3 (≠ T5), D322 (≠ K347)
5qihA Pandda analysis group deposition of models with modelled events (e.G. Bound ligands) -- crystal structure of hao1 in complex with z2697514548
33% identity, 95% coverage: 4:369/387 of query aligns to 2:335/344 of 5qihA
- active site: Y129 (= Y130), D157 (= D158), H242 (= H276)
- binding flavin mononucleotide: Y23 (= Y25), Y24 (≠ C26), A76 (≠ P78), T77 (≠ V79), A78 (≠ G80), S105 (= S107), Q127 (= Q128), Y129 (= Y130), K218 (= K252), H242 (= H276), G243 (= G277), R245 (= R279), D273 (= D307), G274 (≠ S308), R277 (= R311), G296 (= G330), R297 (= R331)
- binding 1-methylindazole-3-carboxamide: Y23 (= Y25), A78 (≠ G80), M79 (≠ L81), W107 (≠ M109), Y129 (= Y130), M180 (≠ P181), L187 (= L221), H242 (= H276)
Query Sequence
>WP_110805778.1 NCBI__GCF_003217355.1:WP_110805778.1
MTVITCIDDLKALHRKRTPKMFYDYCESGSYTEQTFRENTTDFAQIRLRQKVAVDMSGRS
TASTMAGQPVAMPVALAPVGLLGMQRADGEIKAARAAAKFGVPFTLSTMSICSIEDVAAQ
SPDPFWFQLYVMRDEDFVDAIIERAKKARCSALVLTLDLQILGQRHKDLKNGLTAPPKLT
PANLIDMATKLTWGREMLATPRRFFGNIVGHAKGVGDAASLMSWTSEQFDPCLDWTKIAR
IRDQWGGKFILKGILDAEDARAAADFGADAIIVSNHGGRQLDGALSSIRMLPEIVQAVGD
KTEVWLDSGIRSGQDILKALALGATGTMIGRAYVHGLGAMGEAGVTKALEVMRKELDISM
ALCGEKRVQDLGRDNLLVPEGFFTTYR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory