Comparing WP_155816855.1 NCBI__GCF_000236685.1:WP_155816855.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
21% identity, 90% coverage: 29:317/322 of query aligns to 5:289/302 of 8hkbA
7ndrD Crystal structure of tphc in an open conformation (see paper)
25% identity, 67% coverage: 29:243/322 of query aligns to 5:214/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
25% identity, 67% coverage: 29:243/322 of query aligns to 5:214/294 of 7ndsA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
24% identity, 83% coverage: 24:290/322 of query aligns to 2:266/300 of 2dvzA
>WP_155816855.1 NCBI__GCF_000236685.1:WP_155816855.1
MAVPFALFANGTSESATSDKQVVYPKGNFDFVAPAGAGGGWDLTIRTVAKVLGDTKLVSV
PMPVRNAPGAGGAVHLGTLQTKKGDDKTITVYSPPIIFFNLNGTSKYGFRNATPLARLIA
DYAAFVVKADSPYKSIMDVMDALKKDPKSVKIGGTSAAGSMDHIQFLIMARAAGVKNLNM
IDYIAFDSDGATQVLGGHIDLFSTSLADVMGLVNSGDLRVLAQTADKRIGTGKAAEIPTC
IEEGINETFQNWRGLFGSPDMPEYAVTYWRDTLSKLAKTPEWAAALTKYGWDNVYLDSPD
FVKFLEKTESDYQVILKEIGMI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory