Comparing WP_156994653.1 NCBI__GCF_000757425.2:WP_156994653.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7dyrZ Cryoem structure of mannose transporter manyz and microcin e492 (mcea) complex (see paper)
91% identity, 96% coverage: 12:285/285 of query aligns to 1:274/274 of 7dyrZ
7xnoZ Cryo-em structure of the bacteriocin-receptor-immunity ternary complex from lactobacillus sakei (see paper)
48% identity, 95% coverage: 14:283/285 of query aligns to 4:301/301 of 7xnoZ
7vlxZ Cryo-em structures of listeria monocytogenes man-pts (see paper)
51% identity, 95% coverage: 14:283/285 of query aligns to 1:298/298 of 7vlxZ
8hfsZ The structure of lcna, lcia, and the man-pts of lactococcus lactis (see paper)
50% identity, 90% coverage: 21:277/285 of query aligns to 10:297/303 of 8hfsZ
>WP_156994653.1 NCBI__GCF_000757425.2:WP_156994653.1
MREMVDTARPTEKKLTPGDIRGVFIRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENN
DARRQAIKRHLEFFNTHPYVAAPVLGVTLAMEEKRANGAEIDDAAINGIKVGLMGPLAGV
GDPIYWGTVRPVFAALGAGIAMSGSLLGPLLFFVLFNIVRLLTRYYGVAYGYRKGIDIVK
DMGGGFLQKMTEGASILGLFVMGALVNKWTHVNIPLVVSTIRDQNGAEHVTTVQTILDQL
MPGLVPLLLTFACMWLLRKKVNALWIIIGFFVIGIVGYAIGLLGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory