Comparing WP_157520500.1 NCBI__GCF_001653335.1:WP_157520500.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
34% identity, 71% coverage: 61:240/255 of query aligns to 35:208/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
34% identity, 71% coverage: 61:240/255 of query aligns to 35:208/215 of 4ymtC
>WP_157520500.1 NCBI__GCF_001653335.1:WP_157520500.1
MGYALAVLLVAGVLGFTTANNGAIATTFLRWEFIADSWEGIAKAFAVNIQVAVGAQVLVL
VVGLALAVMRLLPGRAGRPLRWIATLYVDVFRAIPSIIVLYLVGFGLSLAQVPIVRDFSP
LWLAILALTLTYSAYVAEVYRAGIDSIHPSQWSASRSLGLSYSMTLRTVIVPQAVRRIVP
PLLNDFIGLQKDTALIGVMGVTDAFMQARLVSSNVFNLTPVIVVAVLFVIITIPQARFVD
RLIAGEQARRAGRTS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory