Comparing WP_157892222.1 NCBI__GCF_000058485.1:WP_157892222.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
36% identity, 41% coverage: 240:412/426 of query aligns to 130:288/295 of 6cyzA
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
28% identity, 32% coverage: 250:387/426 of query aligns to 134:264/296 of 1h74B
Sites not aligning to the query:
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
28% identity, 32% coverage: 250:387/426 of query aligns to 134:264/296 of 1h74A
Sites not aligning to the query:
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
28% identity, 32% coverage: 250:387/426 of query aligns to 134:264/296 of 1h73A
Sites not aligning to the query:
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
28% identity, 32% coverage: 250:387/426 of query aligns to 134:264/296 of 1h72C
Sites not aligning to the query:
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
28% identity, 32% coverage: 250:387/426 of query aligns to 134:264/296 of 1fwkA
Sites not aligning to the query:
>WP_157892222.1 NCBI__GCF_000058485.1:WP_157892222.1
MTALSGAVPGAETAAPGGAVRDNPGGAVRSVSGAGDRDLSGAGDRDARGEYRSVPVVGAG
RAGADGAARRVRVRVPATSANLGPGFDAFGLALGLYDEVDVEMTASGLTVDVVGPDEVAQ
DETHLVVRAIRATFDLLGRPQPGLALRCVNRIPHGRGLGSSAAAIVAGIVAAAALDRPDL
GPEFEAGPAANQGDPGVARPGVPADRAATATAAGPAAAAGPGPGDSAGPATSVPAAAAWM
LRLAHDIEGHPDNVAAALSGGFTVAWQDVEGARCLRVDPFAELRPVVFVPTVRQSTEASR
GALPVLVGLPDAARTLGRAALLALTMSAAEPAAAAQRARTLFSATEDLLHQPYRLPAAPA
TGELVARLRALGVPATLSGSGPSVLALAVGGEQAAAAVGAASAEFSVAPLSVDRSGAQVT
RLDPER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory