Comparing WP_159460143.1 NCBI__GCF_900177295.1:WP_159460143.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
32% identity, 96% coverage: 2:280/290 of query aligns to 9:297/305 of Q8K4H1
P95125 Carboxylic ester hydrolase LipN; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 40% coverage: 46:161/290 of query aligns to 111:226/376 of P95125
Sites not aligning to the query:
6ieyA Crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex (see paper)
39% identity, 37% coverage: 63:168/290 of query aligns to 56:163/307 of 6ieyA
Sites not aligning to the query:
4n5iX Crystal structure of a c8-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
31% identity, 52% coverage: 12:162/290 of query aligns to 15:153/311 of 4n5iX
Sites not aligning to the query:
4oukX Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
31% identity, 52% coverage: 12:162/290 of query aligns to 15:153/309 of 4oukX
Sites not aligning to the query:
4po3X Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
31% identity, 52% coverage: 12:162/290 of query aligns to 18:156/309 of 4po3X
Sites not aligning to the query:
8q03A Metagenomic lipase orf30
28% identity, 77% coverage: 39:262/290 of query aligns to 43:291/318 of 8q03A
B5BLW5 Arylesterase; A-esterase; Paraoxonase; EC 3.1.1.2; EC 3.1.8.1 from Saccharolobus solfataricus (Sulfolobus solfataricus) (see paper)
33% identity, 40% coverage: 46:162/290 of query aligns to 52:167/306 of B5BLW5
Sites not aligning to the query:
P15304 Hormone-sensitive lipase; HSL; Monoacylglycerol lipase LIPE; Retinyl ester hydrolase; REH; EC 3.1.1.79; EC 3.1.1.23 from Rattus norvegicus (Rat) (see 2 papers)
38% identity, 31% coverage: 73:162/290 of query aligns to 644:734/1068 of P15304
Sites not aligning to the query:
4ob6A Complex structure of esterase rppe s159a/w187h and substrate (s)-ac- cpa (see paper)
32% identity, 32% coverage: 69:162/290 of query aligns to 77:171/319 of 4ob6A
Sites not aligning to the query:
8pc7A Structure of ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with a derivative of bipyridine phosphonate (see paper)
29% identity, 43% coverage: 65:189/290 of query aligns to 86:211/336 of 8pc7A
Sites not aligning to the query:
6sylA Structure of ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with a derivative of butyl 4-nitrophenyl hexylphosphonate (see paper)
29% identity, 43% coverage: 65:189/290 of query aligns to 89:214/339 of 6sylA
Sites not aligning to the query:
P71668 Esterase LipI; EC 3.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 40% coverage: 45:161/290 of query aligns to 57:175/320 of P71668
Sites not aligning to the query:
6syaA Structure of s192a-ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with methyl (2r)-2-phenylpropanoate (see paper)
28% identity, 43% coverage: 65:189/290 of query aligns to 89:214/339 of 6syaA
Sites not aligning to the query:
6sxyB Structure of s192a-ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with methyl (2s)-2-phenylpropanoate (see paper)
28% identity, 43% coverage: 65:189/290 of query aligns to 89:214/340 of 6sxyB
Sites not aligning to the query:
5mifC Crystal structure of carboxyl esterase 2 (tmelest2) from mycorrhizal fungus tuber melanosporum (see paper)
27% identity, 69% coverage: 72:271/290 of query aligns to 64:281/301 of 5mifC
1qz3A Crystal structure of mutant m211s/r215l of carboxylesterase est2 complexed with hexadecanesulfonate (see paper)
34% identity, 31% coverage: 72:162/290 of query aligns to 74:165/309 of 1qz3A
Sites not aligning to the query:
P16386 Hormone-sensitive lipase; HSL; Monoacylglycerol lipase LIPE; Retinyl ester hydrolase; REH; EC 3.1.1.79; EC 3.1.1.23 from Bos taurus (Bovine) (see 2 papers)
38% identity, 29% coverage: 73:157/290 of query aligns to 345:430/756 of P16386
Sites not aligning to the query:
P23872 Acetyl esterase; EcE; EC 3.1.1.- from Escherichia coli (strain K12) (see paper)
34% identity, 43% coverage: 44:167/290 of query aligns to 71:179/319 of P23872
Sites not aligning to the query:
5hc0A Structure of esterase est22 with p-nitrophenol (see paper)
30% identity, 43% coverage: 65:189/290 of query aligns to 87:212/338 of 5hc0A
Sites not aligning to the query:
>WP_159460143.1 NCBI__GCF_900177295.1:WP_159460143.1
MGGTLWRGYDKAALDRQINLRARTPEHVEFFAHWADDSRRVRAQLDCRLDLPYGEQPLQT
LDYFPAGGGEAPLVAFIHGGYWQSLDKGDFSYLAPAFVEAGVAFASINYTLAPAGRIPQM
VEEIERAVAWLYENAEELGFDREGIVVAGHSAGGHLAAMAAVADWSRHDLPRDLLRGACA
VSGLYQLQPIRLSYQQEVLQLDDAAVAAGSPQALIPEDGPPILLAVGDEEPEEFRDQQAE
FLAAWQARGLSGAAVPLPGRHHFSAIDALGEKDHALHRSVCYLAQNGAIS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory