Comparing WP_167562565.1 NCBI__GCF_001639105.2:WP_167562565.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5a1sD Crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. (see paper)
29% identity, 95% coverage: 17:431/437 of query aligns to 4:426/434 of 5a1sD
5x9rA Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
29% identity, 91% coverage: 36:431/437 of query aligns to 10:411/416 of 5x9rA
5xarD Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
28% identity, 95% coverage: 17:431/437 of query aligns to 6:405/411 of 5xarD
5xasB Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
27% identity, 95% coverage: 17:431/437 of query aligns to 3:401/407 of 5xasB
>WP_167562565.1 NCBI__GCF_001639105.2:WP_167562565.1
MSASAARRSWREVWWGLLDQRIGIVPIPVFVVLIAVFAGAVATGSLSHDINMMIAVLAVC
GFSCGELGKRLPVFRHIGAAAIFATFIPSALAYYHVLPTPMLKAVVDFTKFTNFLYLFIA
CIIVGSVLSMNRDALVKGFFKIFVPLASGAVSAACVGTLVGTLLGLDPKHTFFYIVVPIM
SGGVGEGAIPLSMGYAEILHGNQGEIFAQVLPMVMLGSLMAILMSGLLNFIGKRMPHLTG
NGQLQPGGTDFVKAATKSSGPVDANTVAAAGLFAVTLYLMGVMAQKVVGLPAPVAMLFIA
VMVKVLQLASPSLEAGAGVVYKFFQVAVTYPLLFAMGVAVTPWDKLMSAFTVQNLIIIFC
TVATHMTMGFLVGRMVKMYPIETAIINSCNCGQGGTGDVAILTAANRMQLMPFAQVATRI
GGAITVTLSLIAMANLM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory