SitesBLAST
Comparing WP_169336955.1 NCBI__GCF_000381785.1:WP_169336955.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
36% identity, 99% coverage: 1:352/356 of query aligns to 37:394/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: G40 (= G4), L41 (= L5)
- binding 2-oxoglutaric acid: D213 (≠ A171), P214 (= P172), Y215 (= Y173), G216 (≠ R174), E217 (= E175), G241 (≠ K198), T242 (≠ S199), I246 (≠ T203)
- binding (2E)-pent-2-enedioic acid: G40 (= G4), Y130 (= Y87), N184 (= N142), R376 (= R334)
- binding glutamic acid: L131 (= L88), V360 (= V316), A364 (= A320), R369 (≠ G325)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G61), S105 (= S62), Q106 (= Q63), Y130 (= Y87), N184 (= N142), D212 (= D170), P214 (= P172), Y215 (= Y173), T242 (≠ S199), S244 (= S201), K245 (= K202), R252 (= R209)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
36% identity, 99% coverage: 1:352/356 of query aligns to 37:394/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (= L88), Q135 (= Q92), A364 (= A320), R369 (≠ G325)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: G40 (= G4), Y130 (= Y87), L131 (= L88), A132 (≠ G89), N184 (= N142), R376 (= R334)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G61), S105 (= S62), Q106 (= Q63), Y130 (= Y87), V179 (= V137), N184 (= N142), D212 (= D170), P214 (= P172), Y215 (= Y173), T242 (≠ S199), S244 (= S201), K245 (= K202), R252 (= R209)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
36% identity, 99% coverage: 1:352/356 of query aligns to 37:394/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y32), Y130 (= Y87), L275 (= L232)
- binding pyridoxal-5'-phosphate: G104 (= G61), S105 (= S62), Q106 (= Q63), Y130 (= Y87), V179 (= V137), N184 (= N142), D212 (= D170), P214 (= P172), Y215 (= Y173), T242 (≠ S199), S244 (= S201), K245 (= K202), R252 (= R209)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
36% identity, 99% coverage: 1:352/356 of query aligns to 37:394/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G61), S105 (= S62), Q106 (= Q63), Y130 (= Y87), V179 (= V137), N184 (= N142), D212 (= D170), P214 (= P172), Y215 (= Y173), T242 (≠ S199), S244 (= S201), K245 (= K202), R252 (= R209)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
35% identity, 100% coverage: 1:356/356 of query aligns to 37:390/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (= G3), G40 (= G4), G99 (= G61), S100 (= S62), Q101 (= Q63), Y125 (= Y87), N174 (= N142), D202 (= D170), Y205 (= Y173), S235 (= S199), S237 (= S201), K238 (= K202), R245 (= R209), R368 (= R334)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
35% identity, 100% coverage: 1:356/356 of query aligns to 37:390/397 of Q72LL6
- G40 (= G4) binding substrate
- Y70 (= Y32) binding pyridoxal 5'-phosphate
- N174 (= N142) binding pyridoxal 5'-phosphate; binding substrate
- R245 (= R209) binding pyridoxal 5'-phosphate
- R368 (= R334) binding substrate
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
35% identity, 100% coverage: 1:356/356 of query aligns to 29:382/389 of 2z1yA
- binding leucine: G32 (= G4), Y117 (= Y87), R360 (= R334)
- binding pyridoxal-5'-phosphate: G91 (= G61), S92 (= S62), Q93 (= Q63), Y117 (= Y87), N166 (= N142), D194 (= D170), Y197 (= Y173), S227 (= S199), S229 (= S201), K230 (= K202), R237 (= R209)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
35% identity, 100% coverage: 1:356/356 of query aligns to 33:386/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (= G3), G36 (= G4), G95 (= G61), S96 (= S62), Q97 (= Q63), Y121 (= Y87), N170 (= N142), D198 (= D170), Y201 (= Y173), S231 (= S199), S233 (= S201), K234 (= K202), R241 (= R209), R364 (= R334)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
35% identity, 100% coverage: 1:356/356 of query aligns to 33:386/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G61), S96 (= S62), Q97 (= Q63), Y121 (= Y87), N170 (= N142), D198 (= D170), A200 (≠ P172), Y201 (= Y173), S231 (= S199), S233 (= S201), K234 (= K202), R241 (= R209)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
33% identity, 99% coverage: 1:352/356 of query aligns to 34:392/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G61), S103 (= S62), Q104 (= Q63), Y128 (= Y87), V177 (= V137), N182 (= N142), D210 (= D170), P212 (= P172), Y213 (= Y173), T240 (≠ S199), S242 (= S201), K243 (= K202), R250 (= R209)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
31% identity, 85% coverage: 52:353/356 of query aligns to 103:407/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G61), S113 (= S62), Q114 (= Q63), Y138 (= Y87), N194 (= N142), D222 (= D170), P224 (= P172), Y225 (= Y173), T252 (≠ S199), S254 (= S201), K255 (= K202), R262 (= R209)
4ge4A Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 1:342/356 of query aligns to 32:401/422 of 4ge4A
- binding (5-hydroxy-4-{[(1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G34 (= G3), G35 (= G4), L36 (= L5), Y68 (= Y32), G110 (= G61), S111 (= S62), Q112 (= Q63), Y136 (= Y87), N196 (= N142), D224 (= D170), P226 (= P172), Y227 (= Y173), S254 (= S199), S256 (= S201), K257 (= K202), R264 (= R209), R393 (= R334)
Sites not aligning to the query:
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 1:342/356 of query aligns to 36:407/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G4), L40 (= L5), Y74 (= Y32), S117 (= S62), Q118 (= Q63), Y142 (= Y87), N202 (= N142), D230 (= D170), P232 (= P172), Y233 (= Y173), S260 (= S199), S262 (= S201), K263 (= K202), R270 (= R209), R399 (= R334)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 1:342/356 of query aligns to 36:407/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G4), L40 (= L5), Y74 (= Y32), S75 (≠ G33), S77 (= S35), S117 (= S62), Q118 (= Q63), Y142 (= Y87), N202 (= N142), D230 (= D170), P232 (= P172), Y233 (= Y173), S260 (= S199), S262 (= S201), R270 (= R209), L293 (= L232), R399 (= R334)
Sites not aligning to the query:
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 1:342/356 of query aligns to 36:407/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G4), Y74 (= Y32), S75 (≠ G33), S77 (= S35), S117 (= S62), Q118 (= Q63), Y142 (= Y87), N202 (= N142), D230 (= D170), P232 (= P172), Y233 (= Y173), S260 (= S199), S262 (= S201), R270 (= R209), L293 (= L232), R399 (= R334)
Sites not aligning to the query:
4gdyB Kynurenine aminotransferase ii inhibitors
27% identity, 96% coverage: 1:342/356 of query aligns to 36:407/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G39 (= G4), Y74 (= Y32), S75 (≠ G33), G116 (= G61), S117 (= S62), Q118 (= Q63), Y142 (= Y87), N202 (= N142), D230 (= D170), P232 (= P172), S260 (= S199), S262 (= S201), R270 (= R209), R399 (= R334)
Sites not aligning to the query:
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
27% identity, 96% coverage: 1:342/356 of query aligns to 39:410/428 of 6t8qA
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
27% identity, 96% coverage: 1:342/356 of query aligns to 25:396/414 of 2vgzA
3ue8A Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 1:342/356 of query aligns to 19:390/410 of 3ue8A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G22 (= G4), Y57 (= Y32), S100 (= S62), Q101 (= Q63), Y125 (= Y87), N185 (= N142), D213 (= D170), P215 (= P172), Y216 (= Y173), S243 (= S199), S245 (= S201), K246 (= K202), R253 (= R209), R382 (= R334)
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
27% identity, 96% coverage: 1:342/356 of query aligns to 36:407/425 of 5tf5A
Sites not aligning to the query:
Query Sequence
>WP_169336955.1 NCBI__GCF_000381785.1:WP_169336955.1
MAGGLPASSLLPVDLIRASCVLLTDKTELFQYGASRGYAPLIETLTKQHPEQNDKWLICN
GSQQGLDLISRAFLNHGDGVVAEIPAYLGALQSFQLAGAEIYPLYQGSEKSHNQSQPDLI
QLENHFKTGRVKLFYAVPDFHNPTGRVWSEETRTGVCTLCRHYGITLIEDAPYRELRFSG
DQHSSLITLYPEGCIQLKSFSKTGFPGIRMGAMNGPAEFITIAERIKQATDLHTGLPQQA
MINTLLNHAEYPNHLARLQDSYRERYQQLTSELIRQMEKQVQIEVVEGGMFIWLKLTTGS
GSEVAERALTHKLAVVPGAAFYPKGQIVEDNAIRLNFSNTDPINITEAVSRLRRSF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory