Comparing WP_226992378.1 NCBI__GCF_000429905.1:WP_226992378.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
54% identity, 71% coverage: 17:114/139 of query aligns to 8:104/200 of 6j2lA
Sites not aligning to the query:
6j2lB Crystal structure of bi-functional enzyme (see paper)
51% identity, 71% coverage: 17:114/139 of query aligns to 7:106/185 of 6j2lB
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
40% identity, 78% coverage: 25:132/139 of query aligns to 17:111/213 of 7bgmA
Sites not aligning to the query:
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
40% identity, 78% coverage: 25:132/139 of query aligns to 15:109/204 of 7bgnA
Sites not aligning to the query:
>WP_226992378.1 NCBI__GCF_000429905.1:WP_226992378.1
MRGFETSSRQQEEIMIELDFEKTGGLLPAICQDAETGEVLMLAFMNKESWEKTLETGMAT
YWSRSRQELWTKGLTSGNVQKVKEIRVDCDDDTILLKVEQIGGAACHTGHRSCFHKLVEG
DKLTVVGEPVFDPKEVYKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory