Comparing WP_232311000.1 NCBI__GCF_001189915.1:WP_232311000.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
63% identity, 37% coverage: 6:62/156 of query aligns to 374:430/758 of O14289
Sites not aligning to the query:
>WP_232311000.1 NCBI__GCF_001189915.1:WP_232311000.1
MNRHRISGRPVAASVRLALVVPGSGPVKEQAEREGLDRIFRDAGFSWREPGCSMHLAMND
DRYGLLPVALGDAAIGYLFRKAEQVPGYCLHVDLQQQTISDDDGWRQEFAISAFTKTCLL
EGWDDIGLTLAHSVEIKAFEQRRFAQRPWLKSAIRM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory