Comparing WP_234251346.1 NCBI__GCF_002151265.1:WP_234251346.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
54% identity, 99% coverage: 10:636/636 of query aligns to 4:629/630 of 3n2oA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
54% identity, 99% coverage: 10:636/636 of query aligns to 3:628/629 of 3n2oB
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
53% identity, 98% coverage: 13:636/636 of query aligns to 4:623/628 of 3nzqA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 93% coverage: 15:604/636 of query aligns to 43:622/702 of Q9SI64
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
33% identity, 98% coverage: 15:636/636 of query aligns to 4:579/591 of 3nzpB
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
28% identity, 33% coverage: 174:383/636 of query aligns to 106:298/405 of B4XMC6
Sites not aligning to the query:
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
29% identity, 30% coverage: 174:362/636 of query aligns to 104:278/394 of 3c5qA
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
29% identity, 35% coverage: 137:357/636 of query aligns to 95:306/434 of 1tufA
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
29% identity, 35% coverage: 137:357/636 of query aligns to 99:310/438 of Q58497
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
29% identity, 35% coverage: 137:357/636 of query aligns to 95:306/434 of 1twiA
Sites not aligning to the query:
7kh2D Structure of n-citrylornithine decarboxylase bound with plp (see paper)
22% identity, 42% coverage: 99:365/636 of query aligns to 59:309/415 of 7kh2D
Sites not aligning to the query:
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
24% identity, 37% coverage: 126:358/636 of query aligns to 65:286/412 of 7ru7A
Sites not aligning to the query:
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
27% identity, 44% coverage: 77:357/636 of query aligns to 37:289/418 of 4xg1B
Sites not aligning to the query:
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
25% identity, 33% coverage: 137:346/636 of query aligns to 97:304/446 of 1hkvA
Sites not aligning to the query:
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
25% identity, 33% coverage: 137:346/636 of query aligns to 98:305/447 of P9WIU7
Sites not aligning to the query:
2plkA Crystal structure of lysine/ornithine decarboxylase complexed with cadaverine from vibrio vulnificus (see paper)
24% identity, 22% coverage: 223:360/636 of query aligns to 146:269/370 of 2plkA
Sites not aligning to the query:
2pljA Crystal structure of lysine/ornithine decarboxylase complexed with putrescine from vibrio vulnificus (see paper)
24% identity, 22% coverage: 221:360/636 of query aligns to 149:274/376 of 2pljA
Sites not aligning to the query:
1knwA Crystal structure of diaminopimelate decarboxylase
28% identity, 28% coverage: 177:357/636 of query aligns to 107:283/421 of 1knwA
Sites not aligning to the query:
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
28% identity, 28% coverage: 177:357/636 of query aligns to 108:284/420 of P00861
Sites not aligning to the query:
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
28% identity, 28% coverage: 177:357/636 of query aligns to 107:283/419 of 1ko0A
Sites not aligning to the query:
>WP_234251346.1 NCBI__GCF_002151265.1:WP_234251346.1
MGAASGPAQRARRTWNIDQWGSGYFDVDDDGHALVRPLGSEAEGPALPLAPLVDQLREAD
LRLPVLVRFSDILHDRVEQLCEAFDLAMREEEYVGGYTAVYPIKVNQQRRVVEEILATRE
RGHGRVGLEAGSKPELLAVLALSADGPSLIVCNGYKDREYIRLALMGEKLGHRVYLVVEK
FSELPLILEEAERLGVTPRIGLRARLASVGMGKWQDTGGEKSKFGLTAAQMLAVVERLRE
ADSLGSLQLVHFHLGSQIANIRDIQVGLRECARFYQSLLALGAPIDTVDVGGGLGIDYEG
TRSRSFCSINYSMREYARNVVSAFAQACNEAEIPHPHLISESGRALTAHHAVLITNVIGE
ERVNDAAPERLAEDDPQLDELWRVHDLLNGSVEPRELVEAWHDLLQAMSEMHDRFLMGLA
DITVRAEAEGVYFAACARLRERLDSRNRAHREIIDELAEKLADKLFVNFSLFQSVPDVWG
IDQIFPVLPLTGLNREPSRRGVIQDITCDSDGRIDGYVDGQGVETTLPLPEWRDDEERLL
GFFLVGAYQEILGDLHNLFGDTDSVDAALDVNGEWVLSHAQQGDRVSDVLAYVNFDAKVL
RDRLAGQLADSGLPAEEQEHFLDDLSAGLQGYTYLE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory