SitesBLAST
Comparing WP_245258033.1 NCBI__GCF_000166055.1:WP_245258033.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; CP4 EPSP synthase; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see paper)
57% identity, 96% coverage: 2:433/448 of query aligns to 12:448/455 of Q9R4E4
- S29 (= S19) binding 3-phosphoshikimate
- R33 (= R23) binding 3-phosphoshikimate
- A100 (≠ G91) mutation to G: Confers sensitivity to glyphosate allowing glyphosate to bind in its extended, inhibitory conformation.
- S173 (= S164) binding 3-phosphoshikimate
- A174 (= A165) binding 3-phosphoshikimate
- Q175 (= Q166) binding 3-phosphoshikimate
- D326 (= D316) binding 3-phosphoshikimate
- K353 (= K343) binding 3-phosphoshikimate
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
57% identity, 96% coverage: 2:433/448 of query aligns to 7:443/445 of 2pqcA
- active site: K23 (= K18), S24 (= S19), D50 (= D45), N93 (= N89), R123 (= R119), D321 (= D316), E349 (= E344), H399 (= H389), R400 (= R390), T426 (= T416)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K18), S24 (= S19), R28 (= R23), T96 (= T92), R123 (= R119), S168 (= S164), Q170 (= Q166), D321 (= D316), K348 (= K343), E349 (= E344), R352 (= R347), R400 (= R390)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
57% identity, 96% coverage: 2:433/448 of query aligns to 7:443/445 of 2pqbA
- active site: K23 (= K18), S24 (= S19), D50 (= D45), N93 (= N89), R123 (= R119), D321 (= D316), E349 (= E344), H399 (= H389), R400 (= R390), T426 (= T416)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K18), S24 (= S19), R28 (= R23), A95 (≠ G91), T96 (= T92), R123 (= R119), S168 (= S164), Q170 (= Q166), D321 (= D316), K348 (= K343), E349 (= E344), R352 (= R347), R400 (= R390)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
57% identity, 96% coverage: 2:433/448 of query aligns to 7:443/445 of 2ggaA
- active site: K23 (= K18), S24 (= S19), D50 (= D45), N93 (= N89), R123 (= R119), D321 (= D316), E349 (= E344), H399 (= H389), R400 (= R390), T426 (= T416)
- binding glyphosate: K23 (= K18), A94 (≠ S90), A95 (≠ G91), T96 (= T92), R123 (= R119), D321 (= D316), E349 (= E344), R352 (= R347), R400 (= R390)
- binding shikimate-3-phosphate: S24 (= S19), R28 (= R23), S168 (= S164), A169 (= A165), Q170 (= Q166), R195 (= R191), D321 (= D316), K348 (= K343)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
57% identity, 96% coverage: 2:433/448 of query aligns to 7:443/445 of 2gg6A
- active site: K23 (= K18), S24 (= S19), D50 (= D45), N93 (= N89), R123 (= R119), D321 (= D316), E349 (= E344), H399 (= H389), R400 (= R390), T426 (= T416)
- binding shikimate-3-phosphate: S24 (= S19), R28 (= R23), T96 (= T92), S168 (= S164), Q170 (= Q166), D321 (= D316), K348 (= K343)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
44% identity, 95% coverage: 8:432/448 of query aligns to 13:431/440 of 3slhD
- active site: K23 (= K18), S24 (= S19), D50 (= D45), N95 (= N89), R125 (= R119), D317 (= D316), E345 (= E344), H388 (= H389), R389 (= R390), T415 (= T416)
- binding glyphosate: K23 (= K18), G97 (= G91), T98 (= T92), R125 (= R119), Q171 (= Q166), D317 (= D316), E345 (= E344), R348 (= R347), H388 (= H389), R389 (= R390)
- binding shikimate-3-phosphate: S24 (= S19), R28 (= R23), S169 (= S164), Q171 (= Q166), R196 (= R191), D317 (= D316), K344 (= K343)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S19), R28 (= R23), T98 (= T92), Q171 (= Q166), R196 (= R191), D317 (= D316), K344 (= K343)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
44% identity, 95% coverage: 8:432/448 of query aligns to 11:429/438 of Q83E11
- K21 (= K18) binding phosphoenolpyruvate
- S22 (= S19) binding 3-phosphoshikimate
- R26 (= R23) binding 3-phosphoshikimate
- NSGT 93:96 (= NSGT 89:92) Phosphoenolpyruvate
- G95 (= G91) binding phosphoenolpyruvate
- T96 (= T92) binding phosphoenolpyruvate
- R123 (= R119) binding phosphoenolpyruvate
- S167 (= S164) binding 3-phosphoshikimate
- A168 (= A165) binding 3-phosphoshikimate
- Q169 (= Q166) binding 3-phosphoshikimate; binding phosphoenolpyruvate
- D315 (= D316) binding 3-phosphoshikimate
- K342 (= K343) binding 3-phosphoshikimate
- R346 (= R347) binding phosphoenolpyruvate
- R387 (= R390) binding phosphoenolpyruvate
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
44% identity, 95% coverage: 8:432/448 of query aligns to 13:427/434 of 4egrA
- active site: K23 (= K18), S24 (= S19), D50 (= D45), N95 (= N89), R125 (= R119), D313 (= D316), E341 (= E344), H384 (= H389), R385 (= R390), T411 (= T416)
- binding phosphoenolpyruvate: K23 (= K18), G97 (= G91), T98 (= T92), R125 (= R119), D313 (= D316), E341 (= E344), R344 (= R347), R385 (= R390)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
43% identity, 93% coverage: 7:421/448 of query aligns to 9:417/427 of Q9S400
- S21 (= S19) binding 3-phosphoshikimate
- R25 (= R23) binding 3-phosphoshikimate
- S166 (= S164) binding 3-phosphoshikimate
- A167 (= A165) binding 3-phosphoshikimate
- Q168 (= Q166) binding 3-phosphoshikimate
- D312 (= D316) binding 3-phosphoshikimate
- K339 (= K343) binding 3-phosphoshikimate
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
43% identity, 93% coverage: 7:421/448 of query aligns to 9:417/427 of 1rf6A
- active site: K20 (= K18), S21 (= S19), D47 (= D45), N90 (= N89), D115 (≠ A114), R120 (= R119), D312 (= D316), E340 (= E344), H384 (= H389), R385 (= R390), T412 (= T416)
- binding glyphosate: K20 (= K18), G92 (= G91), T93 (= T92), R120 (= R119), Q168 (= Q166), D312 (= D316), E340 (= E344), R343 (= R347), H384 (= H389), R385 (= R390)
- binding shikimate-3-phosphate: S21 (= S19), R25 (= R23), S166 (= S164), Q168 (= Q166), R193 (= R191), I311 (= I315), D312 (= D316), K339 (= K343)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
43% identity, 93% coverage: 7:421/448 of query aligns to 9:417/427 of 1rf4A
- active site: K20 (= K18), S21 (= S19), D47 (= D45), N90 (= N89), D115 (≠ A114), R120 (= R119), D312 (= D316), E340 (= E344), H384 (= H389), R385 (= R390), T412 (= T416)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K18), S21 (= S19), R25 (= R23), G92 (= G91), T93 (= T92), R120 (= R119), S166 (= S164), A167 (= A165), Q168 (= Q166), R193 (= R191), D312 (= D316), K339 (= K343), E340 (= E344), R343 (= R347), H384 (= H389), R385 (= R390)
3nvsA 1.02 angstrom resolution crystal structure of 3-phosphoshikimate 1- carboxyvinyltransferase from vibrio cholerae in complex with shikimate-3-phosphate (partially photolyzed) and glyphosate
31% identity, 92% coverage: 8:421/448 of query aligns to 12:417/426 of 3nvsA
- active site: K22 (= K18), S23 (= S19), D49 (= D45), N94 (= N89), P119 (≠ A114), R124 (= R119), H128 (≠ R123), Q135 (≠ S130), Y142 (≠ E137), E144 (= E138), A247 (= A238), A255 (≠ L246), D314 (= D316), E342 (= E344), H386 (= H389), R387 (= R390), K412 (≠ T416)
- binding glyphosate: K22 (= K18), G96 (= G91), R124 (= R119), Q172 (= Q166), D314 (= D316), E342 (= E344), R345 (= R347), H386 (= H389), R387 (= R390)
- binding magnesium ion: E123 (≠ K118), Q145 (≠ G139)
- binding shikimate-3-phosphate: K22 (= K18), S23 (= S19), R27 (= R23), T97 (= T92), S170 (= S164), S171 (≠ A165), Q172 (= Q166), S198 (= S187), Y201 (≠ S190), D314 (= D316), N337 (≠ E339), K341 (= K343)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S19), R27 (= R23), Q172 (= Q166), Y201 (≠ S190), D314 (= D316), K341 (= K343)
Q9KRB0 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
31% identity, 92% coverage: 8:421/448 of query aligns to 12:417/426 of Q9KRB0
- K22 (= K18) binding 3-phosphoshikimate
- S23 (= S19) binding 3-phosphoshikimate
- R27 (= R23) binding 3-phosphoshikimate
- S170 (= S164) binding 3-phosphoshikimate
- S171 (≠ A165) binding 3-phosphoshikimate
- S198 (= S187) binding 3-phosphoshikimate
- D314 (= D316) binding 3-phosphoshikimate
- N337 (≠ E339) binding 3-phosphoshikimate
- K341 (= K343) binding 3-phosphoshikimate
P11043 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplastic; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EC 2.5.1.19 from Petunia hybrida (Petunia) (see paper)
31% identity, 94% coverage: 8:427/448 of query aligns to 85:512/516 of P11043
- G173 (= G91) mutation to A: This mutant becomes resistant to glyphosate due to a lower affinity. Shows a slight reduction in EPSP synthase activity.
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
31% identity, 94% coverage: 8:427/448 of query aligns to 398:826/1555 of 6hqvA
Sites not aligning to the query:
- active site: 123, 145, 187, 243, 253, 257, 261, 264, 268, 280
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding glutamic acid: 139, 145, 187, 243, 257, 264, 280
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45, 76, 79, 107, 108, 109, 112, 132, 133, 135, 139, 140, 145, 154, 175, 176, 177, 180, 280
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
- binding zinc ion: 187, 264, 280
7tm6A Crystal structure of shikimate-3-phosphate and glyphosate bound 3- phosphoshikimate 1-carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 93% coverage: 7:421/448 of query aligns to 10:415/426 of 7tm6A
- binding glyphosate: K21 (= K18), G95 (= G91), R123 (= R119), Q170 (= Q166), D312 (= D316), E340 (= E344), R343 (= R347), H384 (= H389), R385 (= R390)
- binding shikimate-3-phosphate: S22 (= S19), R26 (= R23), T96 (= T92), S168 (= S164), S169 (≠ A165), Q170 (= Q166), S196 (= S187), Y199 (≠ S190), D312 (= D316), N335 (≠ E339), K339 (= K343)
7tm5B Crystal structure of shikimate-3-phosphate bound 3-phosphoshikimate 1- carboxyvinyltransferase from klebsiella pneumoniae
30% identity, 93% coverage: 7:421/448 of query aligns to 11:416/427 of 7tm5B
- binding shikimate-3-phosphate: K22 (= K18), S23 (= S19), R27 (= R23), S169 (= S164), S170 (≠ A165), Q171 (= Q166), S197 (= S187), Y200 (≠ S190), D313 (= D316), N336 (≠ E339), K340 (= K343)
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
29% identity, 92% coverage: 15:428/448 of query aligns to 412:839/1583 of P07547
Sites not aligning to the query:
- 44:46 binding NAD(+)
- 81:84 binding NAD(+)
- 114:116 binding NAD(+)
- 119 binding NAD(+)
- 139:140 binding NAD(+)
- 161 binding NAD(+)
- 179:182 binding NAD(+)
- 190 binding NAD(+)
- 194 binding Zn(2+)
- 271 binding Zn(2+)
- 287 binding Zn(2+)
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
30% identity, 93% coverage: 7:421/448 of query aligns to 11:416/427 of 2pq9A
- active site: K22 (= K18), S23 (= S19), D49 (= D45), N94 (= N89), P119 (≠ A114), R124 (= R119), D313 (= D316), E341 (= E344), H385 (= H389), R386 (= R390), K411 (≠ T416)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K18), S23 (= S19), R27 (= R23), G96 (= G91), T97 (= T92), R124 (= R119), S169 (= S164), S170 (≠ A165), Q171 (= Q166), S197 (= S187), Y200 (≠ S190), D313 (= D316), N336 (≠ E339), K340 (= K343), R344 (= R347), H385 (= H389), R386 (= R390), K411 (≠ T416)
2aa9A Epsp synthase liganded with shikimate (see paper)
30% identity, 93% coverage: 7:421/448 of query aligns to 11:416/427 of 2aa9A
- active site: K22 (= K18), S23 (= S19), D49 (= D45), N94 (= N89), P119 (≠ A114), R124 (= R119), D313 (= D316), E341 (= E344), H385 (= H389), R386 (= R390), K411 (≠ T416)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K18), S23 (= S19), R27 (= R23), T97 (= T92), Q171 (= Q166), Y200 (≠ S190), D313 (= D316), K340 (= K343)
Query Sequence
>WP_245258033.1 NCBI__GCF_000166055.1:WP_245258033.1
MSRKSGRLQGAVVVPGDKSISHRALILGALAEGRTRITGLLEAEDILCTARALEALGAGV
ERDADGAWTVTGRGLGGLAAPAGDLDFGNSGTGARLMMGVVAGHPLAARFTGDASLQKRP
MGRVLAPLQSMGLAIEEEGRNTLPLTLVGTGDLVPISYRLPVPSAQVKSAVLLAGLFASG
ETSVIESEKSRDHTEKMLRYFGAEISVEPFEGGLRIALEGRRTLQGQPVAVPGDPSSAAF
LVAAALITPASDILVKNVLVNPTRTGFYETLAEMGADISFENEREVSGEPVADIRARTSE
LRGVTVPAARAPSMIDEYPMLAALATLAEGETLMEGLAELRVKESDRLAAMVDGLVACGA
IAHARGDTLTVLGLPKVRGGATIKTHMDHRIAMSFLVLGLATEEPVTVDDASMIATSFPE
FRTLMQQVGATLDEPGQASNEARGKDHE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory