Comparing WP_276609542.1 NCBI__GCF_900111775.1:WP_276609542.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
46% identity, 95% coverage: 1:348/366 of query aligns to 8:358/387 of Q6FEQ3
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
41% identity, 96% coverage: 11:362/366 of query aligns to 9:355/358 of P45131
Sites not aligning to the query:
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
40% identity, 98% coverage: 5:362/366 of query aligns to 8:370/374 of D2Z028
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
41% identity, 80% coverage: 2:294/366 of query aligns to 75:368/504 of Q10341
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
37% identity, 95% coverage: 15:363/366 of query aligns to 9:343/346 of 5w8oB
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
35% identity, 96% coverage: 15:366/366 of query aligns to 18:365/368 of 7rytB
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
35% identity, 96% coverage: 15:366/366 of query aligns to 18:365/367 of 8f2lA
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
35% identity, 96% coverage: 14:366/366 of query aligns to 18:366/366 of 6puxA
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
35% identity, 96% coverage: 15:366/366 of query aligns to 19:369/375 of 6iohA
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
35% identity, 95% coverage: 15:363/366 of query aligns to 19:366/366 of 6ioiA
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
33% identity, 95% coverage: 17:364/366 of query aligns to 21:349/350 of 2vavB
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
33% identity, 95% coverage: 17:364/366 of query aligns to 20:347/347 of 2vatA
>WP_276609542.1 NCBI__GCF_900111775.1:WP_276609542.1
MGIVTTQFAEFDVELRLESGRLLGPLTLAYETYGELNADRSNVILVAHAWTGDAHAAGKN
TPDDRKPGWWDDMIGPGKVLDTDRYFVLCSNVIGSCKGSTGPTSTNPRTGKPYNLTFPVL
MVRDMVRAQKLLLDRLGIDSLLTVIGGSMGAMQALEWSILYPEMVRSIIPIAGTGRTSPM
AIALNALARQAIFNDPLWKKGNYKPEHPPADGLALGRAVGHISFLSDVSMQLKFGRRFSA
RHGQFDFFGQFEIERYLDYNGASFVDRFDTNAFLYLAKALDLYDVAWNFESLEEALDQLR
CPSLWFAFTSDWLYTPSQTEEVVTVLRKLGKPVAYHLIESDYGHDSFLVEPEKFTPKVVE
FLQRLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory