Comparing YP_001314169.1 NCBI__GCF_000017145.1:YP_001314169.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
41% identity, 98% coverage: 5:223/224 of query aligns to 30:257/259 of 5eq8A
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
41% identity, 98% coverage: 5:223/224 of query aligns to 31:258/260 of 5eq9B
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 99% coverage: 3:223/224 of query aligns to 114:343/346 of Q6NPM8
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
41% identity, 97% coverage: 7:223/224 of query aligns to 30:255/257 of 5t3jA
Sites not aligning to the query:
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 99% coverage: 3:223/224 of query aligns to 34:257/260 of P95189
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
38% identity, 99% coverage: 3:223/224 of query aligns to 31:254/255 of 5yhtA
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
38% identity, 99% coverage: 3:223/224 of query aligns to 32:255/256 of 5zonA
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 99% coverage: 3:223/224 of query aligns to 38:266/271 of Q9M8S8
Q9K4B1 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
35% identity, 97% coverage: 3:220/224 of query aligns to 36:259/266 of Q9K4B1
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
31% identity, 93% coverage: 4:212/224 of query aligns to 44:267/285 of Q19420
2p3nA Thermotoga maritima impase tm1415 (see paper)
28% identity, 90% coverage: 9:210/224 of query aligns to 38:235/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 90% coverage: 9:210/224 of query aligns to 38:235/256 of O33832
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
29% identity, 89% coverage: 9:207/224 of query aligns to 40:243/262 of 2qflA
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 89% coverage: 9:207/224 of query aligns to 40:243/267 of P0ADG4
Sites not aligning to the query:
6tqoT Rrn anti-termination complex (see paper)
29% identity, 92% coverage: 1:207/224 of query aligns to 19:235/255 of 6tqoT
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
30% identity, 89% coverage: 9:207/224 of query aligns to 44:247/270 of 6ib8B
5dw8A Crystal structure of 2'amp bound saimpase-ii
26% identity, 98% coverage: 1:219/224 of query aligns to 21:241/260 of 5dw8A
O14732 Inositol monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol monophosphatase A2; EC 3.1.3.25 from Homo sapiens (Human) (see 2 papers)
30% identity, 94% coverage: 4:213/224 of query aligns to 49:268/288 of O14732
5j16A Crystal structure of inositol monophosphate bound saimpase-ii
26% identity, 94% coverage: 10:219/224 of query aligns to 26:237/258 of 5j16A
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
29% identity, 94% coverage: 4:213/224 of query aligns to 31:245/259 of 2cziA
>YP_001314169.1 NCBI__GCF_000017145.1:YP_001314169.1
MAKSDASPVTETDRLVEQCLRERIADRFPDHGVLGEEFGAEGLDKEFVWVIDPIDGTKAF
IGGLPVYGTLISLTRGGTPVLGLVDNPTTGDRWLGVSGRTTTLNGTPIRTAATTVLATAF
MANGNPDAFSHPDRGRFESLRTSTRWCVYGGSCIAYGRVADGSVDISIDGGLDPYDYCAL
VPVITGAGGRISDWEGQPLTLSSGNLCVATANEALHRQVLERLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory