Comparing YP_002827150.1 NCBI__GCF_000018545.1:YP_002827150.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A6L4 N-acetylneuraminate lyase; AcNeu lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; NALase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 79% coverage: 1:236/300 of query aligns to 1:235/297 of P0A6L4
Sites not aligning to the query:
3lbcD D-sialic acid aldolase complexed with l-arabinose
31% identity, 79% coverage: 1:236/300 of query aligns to 1:235/296 of 3lbcD
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
31% identity, 77% coverage: 7:236/300 of query aligns to 4:236/297 of 8u8wA
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
28% identity, 91% coverage: 5:276/300 of query aligns to 6:280/310 of 5hwnB
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
28% identity, 91% coverage: 3:276/300 of query aligns to 4:280/304 of 4ur8A
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
31% identity, 76% coverage: 9:236/300 of query aligns to 2:232/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
31% identity, 76% coverage: 9:236/300 of query aligns to 2:232/292 of 1fdyA
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
30% identity, 77% coverage: 7:236/300 of query aligns to 8:240/302 of 2wpbA
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 78% coverage: 3:236/300 of query aligns to 1:237/299 of 4bwlA
Sites not aligning to the query:
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 77% coverage: 7:236/300 of query aligns to 3:235/296 of 4bwlC
Sites not aligning to the query:
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
28% identity, 94% coverage: 16:298/300 of query aligns to 9:290/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
28% identity, 94% coverage: 16:298/300 of query aligns to 9:290/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
28% identity, 94% coverage: 16:298/300 of query aligns to 9:290/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
28% identity, 94% coverage: 16:298/300 of query aligns to 9:290/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
28% identity, 94% coverage: 16:298/300 of query aligns to 9:290/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
28% identity, 94% coverage: 16:298/300 of query aligns to 9:290/291 of 3pueB
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
27% identity, 73% coverage: 11:228/300 of query aligns to 7:227/295 of Q5HG25
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
27% identity, 73% coverage: 11:228/300 of query aligns to 7:227/291 of 3di1B
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
30% identity, 94% coverage: 16:298/300 of query aligns to 9:292/294 of Q8UGL3
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
24% identity, 96% coverage: 11:298/300 of query aligns to 5:294/295 of 1o5kA
>YP_002827150.1 NCBI__GCF_000018545.1:YP_002827150.1
MAHDLRSALTGISGILVTPYDAKGEIDPARQKAIVDKAIAAGVQILVANGNTGEFYALTI
EEAEIMVRAAAEHVAGRVPLLAGVGRGVRDACRLARNSRAAGAAALMIHQPPDPFSAPRG
LVDYVKAVSDAAEGLPTVLYLRNDAIGIKAIRELCELPSVIGVKWATPNPLKLAEAIGAT
DPGIVWVGGLAEVWAPAFYAVGARGFTSGLINVWPQRSVAIHAALEEGDYREANRLIARM
RAFEDIRAEEMNGTNVTGVKAALAAIGYDCGATRPPSAWPLTGAQQTALQDFIKSNGIRF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory